| Species : |
Human |
| Source : |
E.coli |
| Tag : |
GST&His |
| Protein Length : |
Met1~Lys103 |
| Description : |
Fractalkine is a transmembrane protein and chemokine involved in the adhesion and migration of leukocytes. The protein encoded by this gene is a receptor for fractalkine. The encoded protein also is a coreceptor for HIV-1, and some variations in this gene lead to increased susceptibility to HIV-1 infection and rapid progression to AIDS. Four transcript variants encoding two different isoforms have been found for this gene. |
| Form : |
20mM Tris, 150mM NaCl, pH8.0, containing 0.01% SKL, 5% Trehalose. |
| Molecular Mass : |
42kDa as determined by SDS-PAGE reducing conditions. |
| AA Sequence : |
MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSIFYSVIFAIGLVGNLLVVFALTNSKKPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNAMCK |
| Endotoxin : |
<1.0EU per 1µg (determined by the LAL method) |
| Purity : |
> 90% |
| Applications : |
Positive Control; Immunogen; SDS-PAGE; WB.
If bio-activity of the protein is needed, please check active protein. |
| Stability : |
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition. |
| Storage : |
Avoid repeated freeze/thaw cycles. Store at 2-8°C for one month. Aliquot and store at -80°C for 12 months. |
| Concentration : |
200µg/mL |
| Reconstitution : |
Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex. |
