Recombinant Human CXCL10, His-tagged

Cat.No. : CXCL10-31H
Product Overview : A DNA sequence encoding human CXCL10(Q9UBH0) corresponding to amino acid (1-98) was expressed with a C-terminal polyhistidine tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 1-98 a.a.
Description : CXCL10, also known as crg-2, belongs to the intercrine alpha (chemokine CxC) family. CXC chemokines are particularly significant for leukocyte infiltration in inflammatory diseases. With a three-dimensional crystal structure, CXCL10’s signaling is mediated by the g protein-coupled receptor CXCR3, which is expressed on activated T cells and plays an important role in directing the migration of T cells, especially during Th1 responses. It is secreted by monocytes, epithelial cells, and endothelial cells in response to IFN gamma or other pro-inflammatory cytokines and stimuli. Binding of CXCL10 to CXCR3 results in pleiotropic effects, including stimulation of monocytes, natural killer and T-cell migration, and modulation of adhesion molecule expression. It is chemotactic for monocytes and T-lymphocytes. Baseline pre-treatment plasma levels of CXCL10 are elevated in patients chronically infected with hepatitis C virus (HCV) of genotypes 1 or 4.
Form : PBS pH7.4
Molecular Mass : The mature form of human CXCL10 consists of 78 amino acids (Val22-Pro98) and has a predicted molecular mass of 8.8kDa. In SDS-PAGE under reducing conditions, it migrates with an apparent molecular mass of 15KDa.
AA Sequence : MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCL NPESKAIKNLLKAVSKERSKRSP
Purity : > 90% by SDS - PAGE
Storage : Store it at +4°C for short term. For long term storage, store it at -20°C - -70°C. Avoid freeze-thaw cycles.
Gene Name CXCL10 chemokine (C-X-C motif) ligand 10 [ Homo sapiens ]
Official Symbol CXCL10
Synonyms CXCL10; chemokine (C-X-C motif) ligand 10; INP10, SCYB10, small inducible cytokine subfamily B (Cys X Cys), member 10; C-X-C motif chemokine 10; C7; crg 2; gIP 10; IFI10; IP 10; mob 1; gamma IP10; gamma-IP10; small-inducible cytokine B10; interferon-inducible cytokine IP-10; 10 kDa interferon gamma-induced protein; protein 10 from interferon (gamma)-induced cell line; small inducible cytokine subfamily B (Cys-X-Cys), member 10; INP10; IP-10; crg-2; mob-1; SCYB10; gIP-10;
Gene ID 3627
mRNA Refseq NM_001565
Protein Refseq NP_001556
MIM 147310
UniProt ID P02778
Chromosome Location 4q21
Pathway CXCR3-mediated signaling events, organism-specific biosystem; Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem;
Function cAMP-dependent protein kinase regulator activity; chemokine activity; receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXCL10 Products

Required fields are marked with *

My Review for All CXCL10 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon