| Species : |
Human |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
22-98 aa |
| Description : |
CXCL10 also known as IP-10 is belonging to the CXC chemokine family. It is encoded by the CXCL10 gene. CXCL10 was originally identified in monocytes, endothelial cells and fibroblasts as a responsor to IFN-γ. This chemokine elicits its effects by binding to the cell surface chemokine receptor CXCR3. CXCL10 has been shown to be a chemoattractant for activated T-lymphocytes and monocytes/macrophages. It also has other roles, such as promotion of T cell adhesion to endothelial cells, and inhibition of bone marrow colony formation and angiogenesis. The mouse homologue of human IP-10, Crg-2, has been cloned and shown to share approximately 67 % amino acid sequence identity with human IP-10. |
| Form : |
Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 50 mM NaCl. |
| Bio-activity : |
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood T-lymphocytes is in a concentration range of 10-50 ng/ml. |
| Molecular Mass : |
Approximately 8.6 kDa, a single non-glycosylated polypeptide chain containing 77 amino acids. |
| AA Sequence : |
VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKEMSKRSP |
| Endotoxin : |
Less than 1 EU/µg of rHuIP-10/CXCL10 as determined by LAL method. |
| Purity : |
>97% by SDS-PAGE and HPLC analysis. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |