Recombinant Human CXCL10 protein

Cat.No. : CXCL10-08H
Product Overview : Recombinant Human CXCL10 protein was expressed in Escherichia coli.
Availability April 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 22-98 aa
Description : CXCL10 also known as IP-10 is belonging to the CXC chemokine family. It is encoded by the CXCL10 gene. CXCL10 was originally identified in monocytes, endothelial cells and fibroblasts as a responsor to IFN-γ. This chemokine elicits its effects by binding to the cell surface chemokine receptor CXCR3. CXCL10 has been shown to be a chemoattractant for activated T-lymphocytes and monocytes/macrophages. It also has other roles, such as promotion of T cell adhesion to endothelial cells, and inhibition of bone marrow colony formation and angiogenesis. The mouse homologue of human IP-10, Crg-2, has been cloned and shown to share approximately 67 % amino acid sequence identity with human IP-10.
Form : Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 50 mM NaCl.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood T-lymphocytes is in a concentration range of 10-50 ng/ml.
Molecular Mass : Approximately 8.6 kDa, a single non-glycosylated polypeptide chain containing 77 amino acids.
AA Sequence : VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKEMSKRSP
Endotoxin : Less than 1 EU/µg of rHuIP-10/CXCL10 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name CXCL10
Official Symbol CXCL10
Synonyms CXCL10; chemokine (C-X-C motif) ligand 10; INP10, SCYB10, small inducible cytokine subfamily B (Cys X Cys), member 10; C-X-C motif chemokine 10; C7; crg 2; gIP 10; IFI10; IP 10; mob 1; gamma IP10; gamma-IP10; small-inducible cytokine B10; interferon-inducible cytokine IP-10; 10 kDa interferon gamma-induced protein; protein 10 from interferon (gamma)-induced cell line; small inducible cytokine subfamily B (Cys-X-Cys), member 10; INP10; IP-10; crg-2; mob-1; SCYB10; gIP-10;
Gene ID 3627
mRNA Refseq NM_001565
Protein Refseq NP_001556
MIM 147310
UniProt ID P02778

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CXCL10 Products

Required fields are marked with *

My Review for All CXCL10 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon