Recombinant Human CXCL10 protein
Cat.No. : | CXCL10-08H |
Product Overview : | Recombinant Human CXCL10 protein was expressed in Escherichia coli. |
Availability | June 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 22-98 aa |
Description : | CXCL10 also known as IP-10 is belonging to the CXC chemokine family. It is encoded by the CXCL10 gene. CXCL10 was originally identified in monocytes, endothelial cells and fibroblasts as a responsor to IFN-γ. This chemokine elicits its effects by binding to the cell surface chemokine receptor CXCR3. CXCL10 has been shown to be a chemoattractant for activated T-lymphocytes and monocytes/macrophages. It also has other roles, such as promotion of T cell adhesion to endothelial cells, and inhibition of bone marrow colony formation and angiogenesis. The mouse homologue of human IP-10, Crg-2, has been cloned and shown to share approximately 67 % amino acid sequence identity with human IP-10. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 50 mM NaCl. |
Bio-activity : | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood T-lymphocytes is in a concentration range of 10-50 ng/ml. |
Molecular Mass : | Approximately 8.6 kDa, a single non-glycosylated polypeptide chain containing 77 amino acids. |
AA Sequence : | VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKEMSKRSP |
Endotoxin : | Less than 1 EU/µg of rHuIP-10/CXCL10 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | CXCL10 |
Official Symbol | CXCL10 |
Synonyms | CXCL10; chemokine (C-X-C motif) ligand 10; INP10, SCYB10, small inducible cytokine subfamily B (Cys X Cys), member 10; C-X-C motif chemokine 10; C7; crg 2; gIP 10; IFI10; IP 10; mob 1; gamma IP10; gamma-IP10; small-inducible cytokine B10; interferon-inducible cytokine IP-10; 10 kDa interferon gamma-induced protein; protein 10 from interferon (gamma)-induced cell line; small inducible cytokine subfamily B (Cys-X-Cys), member 10; INP10; IP-10; crg-2; mob-1; SCYB10; gIP-10; |
Gene ID | 3627 |
mRNA Refseq | NM_001565 |
Protein Refseq | NP_001556 |
MIM | 147310 |
UniProt ID | P02778 |
◆ Recombinant Proteins | ||
Cxcl10-2774H | Recombinant Hamster Cxcl10 Protein, His-tagged | +Inquiry |
CXCL10-583HFL | Recombinant Full Length Human CXCL10 Protein, C-Flag-tagged | +Inquiry |
Cxcl10-40M | Active Recombinant Mouse Cxcl10 Protein (Pro23-Pro98), N-His tagged, Animal-free, Carrier-free | +Inquiry |
Cxcl10-076M | Recombinant Mouse Cxcl10 Protein, MYC/DDK-tagged | +Inquiry |
CXCL10-1105R | Recombinant Rhesus monkey CXCL10 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL10-7172HCL | Recombinant Human CXCL10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCL10 Products
Required fields are marked with *
My Review for All CXCL10 Products
Required fields are marked with *
0
Inquiry Basket