Recombinant Human CXCL10 Protein, Fc/His-tagged
| Cat.No. : | CXCL10-025H |
| Product Overview : | Purified recombinant protein of Human chemokine (C-X-C motif) ligand 10 (CXCL10) was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | Fc&His |
| Description : | Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3. |
| Molecular Mass : | 36.6 kDa |
| AA Sequence : | VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSPVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH |
| Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
| Purity : | > 95% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4 |
| Gene Name | CXCL10 chemokine (C-X-C motif) ligand 10 [ Homo sapiens ] |
| Official Symbol | CXCL10 |
| Synonyms | CXCL10; chemokine (C-X-C motif) ligand 10; INP10, SCYB10, small inducible cytokine subfamily B (Cys X Cys), member 10; C-X-C motif chemokine 10; C7; crg 2; gIP 10; IFI10; IP 10; mob 1; gamma IP10; gamma-IP10; small-inducible cytokine B10; interferon-inducible cytokine IP-10; 10 kDa interferon gamma-induced protein; protein 10 from interferon (gamma)-induced cell line; small inducible cytokine subfamily B (Cys-X-Cys), member 10; INP10; IP-10; crg-2; mob-1; SCYB10; gIP-10; |
| Gene ID | 3627 |
| mRNA Refseq | NM_001565 |
| Protein Refseq | NP_001556 |
| MIM | 147310 |
| UniProt ID | P02778 |
| ◆ Recombinant Proteins | ||
| CXCL10-186H | Active Recombinant Human CXCL10 Protein (Val22-Pro98), N-His tagged, Animal-free, Carrier-free | +Inquiry |
| CXCL10-025H | Recombinant Human CXCL10 Protein, Fc/His-tagged | +Inquiry |
| Cxcl10-190M | Recombinant Mouse X-C motif chemokine ligand 10 Protein, Tag Free | +Inquiry |
| CXCL10-4342C | Recombinant Caprine CXCL10 Protein | +Inquiry |
| CXCL10-65R | Active Recombinant Rhesus CXCL10 protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CXCL10-7172HCL | Recombinant Human CXCL10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCL10 Products
Required fields are marked with *
My Review for All CXCL10 Products
Required fields are marked with *



