Recombinant Human CXCL12 protein, His-tagged

• Cat.No.: CXCL12-5234H
• Product Overview: Recombinant Human CXCL12 protein(19-89 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 19-89 aa
• Tag: N-His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Purity: 75%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
• AA Sequence: SDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK

Gene Information

• Gene Name: CXCL12 chemokine (C-X-C motif) ligand 12 [ Homo sapiens ]
• Official Symbol: CXCL12
• Synonyms: CXCL12; chemokine (C-X-C motif) ligand 12; SDF1, SDF1A, SDF1B, stromal cell derived factor 1; stromal cell-derived factor 1; PBSF; SCYB12; SDF 1a; SDF 1b; TLSF a; TLSF b; TPAR1; intercrine reduced in hepatomas; pre-B cell growth-stimulating factor; IRH; SDF1; TLSF; SDF1A; SDF1B
• Gene ID: 6387
• mRNA Refseq: NM_000609
• Protein Refseq: NP_000600
• MIM: 600835
• UniProt ID: P48061