Recombinant Human CXCL12 protein, His-tagged
Cat.No. : | CXCL12-5234H |
Product Overview : | Recombinant Human CXCL12 protein(19-89 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 19-89 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 75%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | SDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK |
Gene Name | CXCL12 chemokine (C-X-C motif) ligand 12 [ Homo sapiens ] |
Official Symbol | CXCL12 |
Synonyms | CXCL12; chemokine (C-X-C motif) ligand 12; SDF1, SDF1A, SDF1B, stromal cell derived factor 1; stromal cell-derived factor 1; PBSF; SCYB12; SDF 1a; SDF 1b; TLSF a; TLSF b; TPAR1; intercrine reduced in hepatomas; pre-B cell growth-stimulating factor; IRH; SDF1; TLSF; SDF1A; SDF1B; |
Gene ID | 6387 |
mRNA Refseq | NM_000609 |
Protein Refseq | NP_000600 |
MIM | 600835 |
UniProt ID | P48061 |
◆ Recombinant Proteins | ||
CXCL12-192H | Recombinant Human CXCL12 Protein, DYKDDDDK-tagged | +Inquiry |
CXCL12-552H | Recombinant Human Chemokine (C-X-C motif) Ligand 12, HIgG1 Fc-tagged | +Inquiry |
Cxcl12-2510M | Recombinant Mouse Cxcl12 protein, His-tagged | +Inquiry |
CXCL12-1219H | Recombinant Human CXCL12 Protein, His-tagged | +Inquiry |
CXCL12-21H | Active Recombinant Human CXCL12, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL12-3016HCL | Recombinant Human CXCL12 cell lysate | +Inquiry |
CXCL12-1863CCL | Recombinant Cynomolgus CXCL12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CXCL12 Products
Required fields are marked with *
My Review for All CXCL12 Products
Required fields are marked with *
0
Inquiry Basket