Recombinant Human CXCL12 protein, His-tagged
| Cat.No. : | CXCL12-5234H |
| Product Overview : | Recombinant Human CXCL12 protein(19-89 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 19-89 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 75%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | SDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK |
| Gene Name | CXCL12 chemokine (C-X-C motif) ligand 12 [ Homo sapiens ] |
| Official Symbol | CXCL12 |
| Synonyms | CXCL12; chemokine (C-X-C motif) ligand 12; SDF1, SDF1A, SDF1B, stromal cell derived factor 1; stromal cell-derived factor 1; PBSF; SCYB12; SDF 1a; SDF 1b; TLSF a; TLSF b; TPAR1; intercrine reduced in hepatomas; pre-B cell growth-stimulating factor; IRH; SDF1; TLSF; SDF1A; SDF1B; |
| Gene ID | 6387 |
| mRNA Refseq | NM_000609 |
| Protein Refseq | NP_000600 |
| MIM | 600835 |
| UniProt ID | P48061 |
| ◆ Recombinant Proteins | ||
| CXCL12-442H | Active Recombinant Human/Feline CXCL12 | +Inquiry |
| CXCL12-23H | Recombinant Human CXCL12 Protein, Biotin-tagged | +Inquiry |
| CXCL12-932R | Recombinant Rhesus Macaque CXCL12 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CXCL12-5382H | Recombinant Human CXCL12 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CXCL12-033H | Recombinant Human CXCL12 Protein, Biotinylated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CXCL12-3016HCL | Recombinant Human CXCL12 cell lysate | +Inquiry |
| CXCL12-1863CCL | Recombinant Cynomolgus CXCL12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCL12 Products
Required fields are marked with *
My Review for All CXCL12 Products
Required fields are marked with *
