Recombinant Human CXCL14 protein, His-tagged
Cat.No. : | CXCL14-2599H |
Product Overview : | Recombinant Human CXCL14 protein(1-111 aa), fused to His tag, was expressed in E. coli. |
Availability | September 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-111 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CXCL14 chemokine (C-X-C motif) ligand 14 [ Homo sapiens ] |
Official Symbol | CXCL14 |
Synonyms | CXCL14; chemokine (C-X-C motif) ligand 14; SCYB14, small inducible cytokine subfamily B (Cys X Cys), member 14 (BRAK); C-X-C motif chemokine 14; BMAC; bolekine; BRAK; breast and kidney; Kec; KS1; MIP 2g; NJAC; MIP-2 gamma; chemokine BRAK; tumor-suppressing chemokine; small-inducible cytokine B14; CXC chemokine in breast and kidney; small inducible cytokine subfamily B (Cys-X-Cys), member 14 (BRAK); KEC; MIP2G; MIP-2g; SCYB14; MGC10687; |
Gene ID | 9547 |
mRNA Refseq | NM_004887 |
Protein Refseq | NP_004878 |
MIM | 604186 |
UniProt ID | O95715 |
◆ Recombinant Proteins | ||
CXCL14-11720H | Recombinant Human CXCL14, GST-tagged | +Inquiry |
Cxcl14-5252M | Recombinant Mouse Cxcl14 protein, His-tagged | +Inquiry |
CXCL14-2285HF | Recombinant Full Length Human CXCL14 Protein, GST-tagged | +Inquiry |
CXCL14-2281H | Recombinant Human CXCL14 Protein (Ser35-Glu111), N-GST tagged | +Inquiry |
CXCL14-014H | Recombinant Human CXCL14 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL14-7169HCL | Recombinant Human CXCL14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCL14 Products
Required fields are marked with *
My Review for All CXCL14 Products
Required fields are marked with *