Recombinant Human CXCL14 protein, His-tagged

• Cat.No.: CXCL14-2599H
• Product Overview: Recombinant Human CXCL14 protein(1-111 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-111 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: CXCL14 chemokine (C-X-C motif) ligand 14 [ Homo sapiens ]
• Official Symbol: CXCL14
• Synonyms: CXCL14; chemokine (C-X-C motif) ligand 14; SCYB14, small inducible cytokine subfamily B (Cys X Cys), member 14 (BRAK); C-X-C motif chemokine 14; BMAC; bolekine; BRAK; breast and kidney; Kec; KS1; MIP 2g; NJAC; MIP-2 gamma; chemokine BRAK; tumor-suppressing chemokine; small-inducible cytokine B14; CXC chemokine in breast and kidney; small inducible cytokine subfamily B (Cys-X-Cys), member 14 (BRAK); KEC; MIP2G; MIP-2g; SCYB14; MGC10687
• Gene ID: 9547
• mRNA Refseq: NM_004887
• Protein Refseq: NP_004878
• MIM: 604186
• UniProt ID: O95715