Recombinant Human CXCR2 protein, His-SUMO-tagged
Cat.No. : | CXCR2-3110H |
Product Overview : | Recombinant Human CXCR2 protein(P25025)(1-40aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
Source : | E. coli |
Species : | Human |
Tag : | His-SUMO |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 20.6 kDa |
Protein length : | 1-40aa |
AA Sequence : | MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name : | CXCR2 chemokine (C-X-C motif) receptor 2 [ Homo sapiens ] |
Official Symbol : | CXCR2 |
Synonyms : | CXCR2; chemokine (C-X-C motif) receptor 2; IL8RB, interleukin 8 receptor, beta; C-X-C chemokine receptor type 2; CD182; CMKAR2; CXC-R2; CXCR-2; IL-8R B; GRO/MGSA receptor; IL-8 receptor type 2; interleukin 8 receptor B; chemokine (CXC) receptor 2; interleukin 8 receptor, beta; interleukin 8 receptor type 2; interleukin-8 receptor type B; CXCR2 gene for IL8 receptor type B; high affinity interleukin-8 receptor B; IL8R2; IL8RA; IL8RB; CDw128b; |
Gene ID : | 3579 |
mRNA Refseq : | NM_001168298 |
Protein Refseq : | NP_001161770 |
MIM : | 146928 |
UniProt ID : | P25025 |
Products Types
◆ Recombinant Protein | ||
CXCR2-2100M | Recombinant Mouse CXCR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CXCR2-1352R | Recombinant Rat CXCR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cxcr2-905M | Recombinant Mouse Cxcr2 Protein, MYC/DDK-tagged | +Inquiry |
Cxcr2-2168M | Recombinant Mouse Cxcr2 Protein, His-tagged | +Inquiry |
CXCR2-2179H | Recombinant Human CXCR2 Protein, GST-tagged | +Inquiry |
◆ Assay kits | ||
Kit-1190 | cAMP CXCR2 (IL8RB) CHO-K1 GPCR Assay Kit | +Inquiry |
Kit-1191 | CXCR2 (IL8RB) HEK 293 β-Arrestin GPCR Assay Kit | +Inquiry |
Kit-1193 | CXCR2 Activated GPCR Internalization Assay Kit | +Inquiry |
Kit-1192 | CXCR2 (IL8RB) CHO-K1 β-Arrestin GPCR Assay Kit | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket