Recombinant Human CXCR2 protein, His-SUMO-tagged
Cat.No. : | CXCR2-3110H |
Product Overview : | Recombinant Human CXCR2 protein(P25025)(1-40aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-40aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 20.6 kDa |
AA Sequence : | MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CXCR2 chemokine (C-X-C motif) receptor 2 [ Homo sapiens ] |
Official Symbol | CXCR2 |
Synonyms | CXCR2; chemokine (C-X-C motif) receptor 2; IL8RB, interleukin 8 receptor, beta; C-X-C chemokine receptor type 2; CD182; CMKAR2; CXC-R2; CXCR-2; IL-8R B; GRO/MGSA receptor; IL-8 receptor type 2; interleukin 8 receptor B; chemokine (CXC) receptor 2; interleukin 8 receptor, beta; interleukin 8 receptor type 2; interleukin-8 receptor type B; CXCR2 gene for IL8 receptor type B; high affinity interleukin-8 receptor B; IL8R2; IL8RA; IL8RB; CDw128b; |
Gene ID | 3579 |
mRNA Refseq | NM_001168298 |
Protein Refseq | NP_001161770 |
MIM | 146928 |
UniProt ID | P25025 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCR2 Products
Required fields are marked with *
My Review for All CXCR2 Products
Required fields are marked with *