Recombinant Human CXCR2 protein, His-SUMO-tagged

Cat.No. : CXCR2-3110H
Product Overview : Recombinant Human CXCR2 protein(P25025)(1-40aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1-40aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 20.6 kDa
AA Sequence : MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCE
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name CXCR2 chemokine (C-X-C motif) receptor 2 [ Homo sapiens ]
Official Symbol CXCR2
Synonyms CXCR2; chemokine (C-X-C motif) receptor 2; IL8RB, interleukin 8 receptor, beta; C-X-C chemokine receptor type 2; CD182; CMKAR2; CXC-R2; CXCR-2; IL-8R B; GRO/MGSA receptor; IL-8 receptor type 2; interleukin 8 receptor B; chemokine (CXC) receptor 2; interleukin 8 receptor, beta; interleukin 8 receptor type 2; interleukin-8 receptor type B; CXCR2 gene for IL8 receptor type B; high affinity interleukin-8 receptor B; IL8R2; IL8RA; IL8RB; CDw128b;
Gene ID 3579
mRNA Refseq NM_001168298
Protein Refseq NP_001161770
MIM 146928
UniProt ID P25025

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXCR2 Products

Required fields are marked with *

My Review for All CXCR2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon