Recombinant Human CXCR4

• Cat.No.: CXCR4-504H
• Product Overview: Recombinant Human CXCR4 was expressed in wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Description: This gene encodes a CXC chemokine receptor specific for stromal cell-derived factor-1. The protein has 7 transmembrane regions and is located on the cell surface. It acts with the CD4 protein to support HIV entry into cells and is also highly expressed in breast cancer cells. Mutations in this gene have been associated with WHIM (warts, hypogammaglobulinemia, infections, and myelokathexis) syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
• Form: Liquid
• Molecular Mass: 39.7 kDa
• AA Sequence: MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDK YRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKL LAEKVVYVGVWIPALLLTIPDFIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISK LSHSKGHQKRKALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPI LYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
• Applications: Antibody Production; Functional Study; Compound Screening
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH 8.0 containing 2% glycerol.
• Publications:
  The development and characterization of SDF1α-elastin-like-peptide nanoparticles for wound healing (2016)

Gene Information

• Gene Name: CXCR4 chemokine (C-X-C motif) receptor 4 [ Homo sapiens ]
• Official Symbol: CXCR4
• Synonyms: CXCR4; chemokine (C-X-C motif) receptor 4; chemokine (C X C motif), receptor 4 (fusin); C-X-C chemokine receptor type 4; CD184; D2S201E; fusin; HM89; HSY3RR; LESTR; NPY3R; NPYR; NPYY3R; CXC-R4; CXCR-4; CD184 antigen; SDF-1 receptor; neuropeptide Y receptor Y3; seven transmembrane helix receptor; stromal cell-derived factor 1 receptor; lipopolysaccharide-associated protein 3; seven-transmembrane-segment receptor, spleen; leukocyte-derived seven transmembrane domain receptor; leukocyte-derived seven-transmembrane-domain receptor; FB22; LAP3; LCR1; WHIM; NPYRL
• Gene ID: 7852
• mRNA Refseq: NM_001008540
• Protein Refseq: NP_001008540
• MIM: 162643
• UniProt ID: P61073
• Chromosome Location: 2q21
• Pathway: Axon guidance; Cardiac Progenitor Differentiation; Class A/1 (Rhodopsin-like receptors)
• Function: C-X-C chemokine receptor activity; G-protein coupled receptor activity; myosin light chain binding

Citation

The development and characterization of SDF1α-elastin-like-peptide nanoparticles for wound healing

Journal: Journal of controlled release : official journal of the Controlled Release Society    PubMed ID: 27094603    Data: 2017/6/28

Authors: Agnes Yeboah, Rick I. Cohen, Francois Berthiaume

Article Snippet:The chip temperature was set to 37°C.The chip temperature was set to 37°C.. Kinetic experiments were done with 5 different concentrations of recombinant human CXCR4 (Creative BioMart) diluted in PBS (0.74nM to 60nM).. Sensograms obtained for SDF1-ELP and SDF1 were subtracted from the reference channel signal and the curves were fitted to a one-site interaction model using the Biacore T200 software.Sensograms obtained for SDF1-ELP and SDF1 were subtracted from the reference channel signal and the curves were fitted to a one-site interaction model using the Biacore T200 software.