Recombinant Human CXCR6 protein, GST-tagged
Cat.No. : | CXCR6-301461H |
Product Overview : | Recombinant Human CXCR6 (1-32 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
Source : | E. coli |
Species : | Human |
Tag : | GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Protein length : | Met1-Val32 |
AA Sequence : | MAEHDYHEDYGFSSFNDSSQEEHQDFLQFSKV |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name : | CXCR6 chemokine (C-X-C motif) receptor 6 [ Homo sapiens ] |
Official Symbol : | CXCR6 |
Synonyms : | CXCR6; chemokine (C-X-C motif) receptor 6; C-X-C chemokine receptor type 6; BONZO; CD186; STRL33; TYMSTR; CDw186; CXC-R6; CXCR-6; G protein-coupled receptor; G-protein coupled receptor bonzo; G-protein coupled receptor STRL33; |
Gene ID : | 10663 |
mRNA Refseq : | NM_006564 |
Protein Refseq : | NP_006555 |
MIM : | 605163 |
UniProt ID : | O00574 |
Products Types
◆ Recombinant Protein | ||
CXCR6-2184H | Recombinant Human CXCR6 Protein, GST-tagged | +Inquiry |
CXCR6-2103M | Recombinant Mouse CXCR6 Protein, His (Fc)-Avi-tagged | +Inquiry |
CXCR6-2183H | Recombinant Human CXCR6 Protein | +Inquiry |
CXCR6-941R | Recombinant Rhesus Macaque CXCR6 Protein, His (Fc)-Avi-tagged | +Inquiry |
CXCR6-1116R | Recombinant Rhesus monkey CXCR6 Protein, His-tagged | +Inquiry |
◆ Lysates | ||
CXCR6-7160HCL | Recombinant Human CXCR6 293 Cell Lysate | +Inquiry |
◆ Assay kits | ||
Kit-1205 | CXCR6 CHO-K1 β-Arrestin GPCR Assay Kit | +Inquiry |
Kit-1204 | CXCR6 HEK 293 β-Arrestin GPCR Assay Kit | +Inquiry |
Kit-1203 | CXCR6 Total GPCR Internalization Assay Kit | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket