Recombinant Human CYB561D1 Protein, GST-tagged

Cat.No. : CYB561D1-2210H
Product Overview : Human CYB561D1 full-length ORF (BAC04767.1, 1 a.a. - 229 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CYB561D1 (Cytochrome B561 Family Member D1) is a Protein Coding gene. An important paralog of this gene is CYB561D2.
Molecular Mass : 51.8 kDa
AA Sequence : MQPLEVGLVPAPAGEPRLTRWLRRGSGILAHLVALGFTIFLTALSRPGTSLFSWHPVFMALAFCLCMAEAILLFSPEHSLFFFCSRKARIRLHWAGQTLAILCAALGLGFIISSRTRSELPHLVSWHSWVGALTLLATAVQALCGLCLLCPRAARVSRVARLKLYHLTCGLVVYLMATVTVLLGMYSVWFQAQIKGAAWYLCLALPVYPALVIMHQISRSYLPRKKMEM
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CYB561D1 cytochrome b-561 domain containing 1 [ Homo sapiens ]
Official Symbol CYB561D1
Synonyms RP5-831G13.3
Gene ID 284613
mRNA Refseq NM_182580.2
Protein Refseq NP_872386.1
UniProt ID Q8N8Q1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CYB561D1 Products

Required fields are marked with *

My Review for All CYB561D1 Products

Required fields are marked with *

0
cart-icon