Recombinant Human CYB561D1 Protein, GST-tagged
Cat.No. : | CYB561D1-2210H |
Product Overview : | Human CYB561D1 full-length ORF (BAC04767.1, 1 a.a. - 229 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CYB561D1 (Cytochrome B561 Family Member D1) is a Protein Coding gene. An important paralog of this gene is CYB561D2. |
Molecular Mass : | 51.8 kDa |
AA Sequence : | MQPLEVGLVPAPAGEPRLTRWLRRGSGILAHLVALGFTIFLTALSRPGTSLFSWHPVFMALAFCLCMAEAILLFSPEHSLFFFCSRKARIRLHWAGQTLAILCAALGLGFIISSRTRSELPHLVSWHSWVGALTLLATAVQALCGLCLLCPRAARVSRVARLKLYHLTCGLVVYLMATVTVLLGMYSVWFQAQIKGAAWYLCLALPVYPALVIMHQISRSYLPRKKMEM |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CYB561D1 cytochrome b-561 domain containing 1 [ Homo sapiens ] |
Official Symbol | CYB561D1 |
Synonyms | RP5-831G13.3 |
Gene ID | 284613 |
mRNA Refseq | NM_182580.2 |
Protein Refseq | NP_872386.1 |
UniProt ID | Q8N8Q1 |
◆ Recombinant Proteins | ||
RFL6636MF | Recombinant Full Length Mouse Cytochrome B561 Domain-Containing Protein 1(Cyb561D1) Protein, His-Tagged | +Inquiry |
CYB561D1-2210H | Recombinant Human CYB561D1 Protein, GST-tagged | +Inquiry |
CYB561D1-2376HF | Recombinant Full Length Human CYB561D1 Protein, GST-tagged | +Inquiry |
RFL19975HF | Recombinant Full Length Human Probable Transmembrane Reductase Cyb561D1(Cyb561D1) Protein, His-Tagged | +Inquiry |
CYB561D1-4120M | Recombinant Mouse CYB561D1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYB561D1-7148HCL | Recombinant Human CYB561D1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYB561D1 Products
Required fields are marked with *
My Review for All CYB561D1 Products
Required fields are marked with *
0
Inquiry Basket