Recombinant Full Length Mouse Cytochrome B561 Domain-Containing Protein 1(Cyb561D1) Protein, His-Tagged
Cat.No. : | RFL6636MF |
Product Overview : | Recombinant Full Length Mouse Cytochrome b561 domain-containing protein 1(Cyb561d1) Protein (A2AE42) (1-229aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-229) |
Form : | Lyophilized powder |
AA Sequence : | MHSMEVGLVPAPAREPRLTRWLRRGSGILAHLIALGFTIFLTVLSRPGTSLFSWHPVFMA LAFCLCMAEAILLFSPEHSLFFFCSRKTRIRLHWAGQTMAILCAVLGLGFIISSKIRSEM SHLVSWHSWIGALTLLATGGQALCGLCLLCPRAARVSRVARLKLYHLTCGLVVYLMATVT VLLGMYSVWFQAQIKGTAWYLCLGLPLYPALVIMHQISSSYLPRKKVEI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cyb561d1 |
Synonyms | Cyb561d1; Probable transmembrane reductase CYB561D1; Cytochrome b561 domain-containing protein 1 |
UniProt ID | A2AE42 |
◆ Recombinant Proteins | ||
CYB561D1-4120M | Recombinant Mouse CYB561D1 Protein | +Inquiry |
CYB561D1-2107M | Recombinant Mouse CYB561D1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CYB561D1-1311Z | Recombinant Zebrafish CYB561D1 | +Inquiry |
RFL6636MF | Recombinant Full Length Mouse Cytochrome B561 Domain-Containing Protein 1(Cyb561D1) Protein, His-Tagged | +Inquiry |
RFL19975HF | Recombinant Full Length Human Probable Transmembrane Reductase Cyb561D1(Cyb561D1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYB561D1-7148HCL | Recombinant Human CYB561D1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cyb561d1 Products
Required fields are marked with *
My Review for All Cyb561d1 Products
Required fields are marked with *