Recombinant Human CYB5A Protein, GST-tagged
| Cat.No. : | CYB5A-2208H |
| Product Overview : | Human CYB5 full-length ORF ( AAH15182, 1 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is a membrane-bound cytochrome that reduces ferric hemoglobin (methemoglobin) to ferrous hemoglobin, which is required for stearyl-CoA-desaturase activity. Defects in this gene are a cause of type IV hereditary methemoglobinemia. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010] |
| Molecular Mass : | 40.48 kDa |
| AA Sequence : | MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISAVAVALMYRLYMAED |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CYB5A cytochrome b5 type A (microsomal) [ Homo sapiens ] |
| Official Symbol | CYB5A |
| Synonyms | CYB5A; cytochrome b5 type A (microsomal); CYB5, cytochrome b 5 , cytochrome b5 (microsomal); cytochrome b5; type 1 cyt-b5; CYB5; MCB5; |
| Gene ID | 1528 |
| mRNA Refseq | NM_001190807 |
| Protein Refseq | NP_001177736 |
| MIM | 613218 |
| UniProt ID | P00167 |
| ◆ Recombinant Proteins | ||
| RFL23898OF | Recombinant Full Length Rabbit Cytochrome B5(Cyb5A) Protein, His-Tagged | +Inquiry |
| CYB5A-1662HFL | Recombinant Full Length Human CYB5A Protein, C-Flag-tagged | +Inquiry |
| CYB5A-27555TH | Recombinant Human CYB5A, His-tagged | +Inquiry |
| CYB5A-2374HF | Recombinant Full Length Human CYB5A Protein, GST-tagged | +Inquiry |
| CYB5A-11744H | Recombinant Human CYB5A, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CYB5A-7146HCL | Recombinant Human CYB5A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYB5A Products
Required fields are marked with *
My Review for All CYB5A Products
Required fields are marked with *




