Recombinant Human CYB5B protein, hFc-tagged

Cat.No. : CYB5B-4523H
Product Overview : Recombinant Human CYB5B protein(O43169)(16-122 aa), fused with C-terminal hFc tag, was expressed in Mammalian Cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Fc
Protein Length : 16-122 aa
Form : For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
Molecular Mass : 43.3 kDa
AASequence : KGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCKSC
Purity : Greater than 95% as determined by SDS-PAGE. Greater than 95% as determined by SEC-HPLC.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.
Gene Name CYB5B cytochrome b5 type B (outer mitochondrial membrane) [ Homo sapiens ]
Official Symbol CYB5B
Synonyms CYB5B; cytochrome b5 type B (outer mitochondrial membrane); cytochrome b5 type B; CYB5 M; type 2 cyt-b5; outer mitochondrial membrane cytochrome b5; cytochrome b5 outer mitochondrial membrane isoform; OMB5; CYB5-M; CYPB5M; DKFZp686M0619;
Gene ID 80777
mRNA Refseq NM_030579
Protein Refseq NP_085056
MIM 611964
UniProt ID O43169

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (1)

Customer Reviews

Write a review

Q&As

Ask a question

Is there an iron or heme content for this particular product? 12/01/2023

The culture medium contains trace elements such as iron (Fe). In theory, these elements should be incorporated into the structure. However, this has not been experimentally verified on the final product.

Ask a Question for All CYB5B Products

Required fields are marked with *

My Review for All CYB5B Products

Required fields are marked with *

0
cart-icon
0
compare icon