Recombinant Full Length Human Cytochrome B5 Type B(Cyb5B) Protein, His-Tagged
Cat.No. : | RFL29580HF |
Product Overview : | Recombinant Full Length Human Cytochrome b5 type B(CYB5B) Protein (O43169) (12-146aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (12-146) |
Form : | Lyophilized powder |
AA Sequence : | KGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCKSCWAYWILPIIGAVLLGFLYRYYTSESKSS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CYB5B |
Synonyms | CYB5B; CYB5M; OMB5; Cytochrome b5 type B; Cytochrome b5 outer mitochondrial membrane isoform |
UniProt ID | O43169 |
◆ Recombinant Proteins | ||
CYB5B-11745H | Recombinant Human CYB5B protein, GST-tagged | +Inquiry |
RFL22458RF | Recombinant Full Length Rat Cytochrome B5 Type B(Cyb5B) Protein, His-Tagged | +Inquiry |
CYB5B-3621H | Recombinant Human CYB5B protein, His-tagged | +Inquiry |
RFL3123MF | Recombinant Full Length Mouse Cytochrome B5 Type B(Cyb5B) Protein, His-Tagged | +Inquiry |
CYB5B-4994H | Recombinant Human CYB5B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYB5B-7145HCL | Recombinant Human CYB5B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (1)
Ask a Question for All CYB5B Products
Required fields are marked with *
My Review for All CYB5B Products
Required fields are marked with *