Recombinant Full Length Human Cytochrome B5 Type B(Cyb5B) Protein, His-Tagged

Cat.No. : RFL29580HF
Product Overview : Recombinant Full Length Human Cytochrome b5 type B(CYB5B) Protein (O43169) (12-146aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Full Length of Mature Protein (12-146)
Form : Lyophilized powder
AA Sequence : KGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCKSCWAYWILPIIGAVLLGFLYRYYTSESKSS
Purity : Greater than 90% as determined by SDS-PAGE.
Applications : SDS-PAGE
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Storage Buffer : Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Gene Name CYB5B
Synonyms CYB5B; CYB5M; OMB5; Cytochrome b5 type B; Cytochrome b5 outer mitochondrial membrane isoform
UniProt ID O43169

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (1)

Customer Reviews

Write a review

Q&As

Ask a question

Is there an iron or heme content for this particular product? 12/01/2023

The culture medium contains trace elements such as iron (Fe). In theory, these elements should be incorporated into the structure. However, this has not been experimentally verified on the final product.

Ask a Question for All CYB5B Products

Required fields are marked with *

My Review for All CYB5B Products

Required fields are marked with *

0
cart-icon
0
compare icon