Recombinant Human CYB5R2 Protein, GST-tagged
Cat.No. : | CYB5R2-2217H |
Product Overview : | Human CYB5R2 full-length ORF ( AAH01346.1, 1 a.a. - 237 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs to the flavoprotein pyridine nucleotide cytochrome reductase family of proteins. Cytochrome b-type NAD(P)H oxidoreductases are implicated in many processes including cholesterol biosynthesis, fatty acid desaturation and elongation, and respiratory burst in neutrophils and macrophages. Cytochrome b5 reductases have soluble and membrane-bound forms that are the product of alternative splicing. In animal cells, the membrane-bound form binds to the endoplasmic reticulum, where it is a member of a fatty acid desaturation complex. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2014] |
Molecular Mass : | 53.4 kDa |
AA Sequence : | MNSRRREPITLQDPEAKYPLPLIEKEKISHNTRRFRFGLPSPDHVLGLPVGNYVQLLAKIDNELVVRAYTPVSSDDDRGFVDLIIKIYFKNVHPQYPEGGKMTQYLENMKIGETIFFRGPRGRLFYHGPGNLGIRPDQTSEPKKTLADHLGMIAGGTGITPMLQLIRHITKDPSDRTRMSLIFANQTEEDILVRKELEEIARTHPDQFDLWYTLDRPPIGPWSAEGATLLSNSAQFH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CYB5R2 cytochrome b5 reductase 2 [ Homo sapiens ] |
Official Symbol | CYB5R2 |
Synonyms | CYB5R2; cytochrome b5 reductase 2; NADH-cytochrome b5 reductase 2; cytochrome b5 reductase b5R.2; B5R.2; |
Gene ID | 51700 |
mRNA Refseq | NM_016229 |
Protein Refseq | NP_057313 |
MIM | 608342 |
UniProt ID | Q6BCY4 |
◆ Recombinant Proteins | ||
CYB5R2-662H | Recombinant Human CYB5R2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CYB5R2-4694C | Recombinant Chicken CYB5R2 | +Inquiry |
CYB5R2-2217H | Recombinant Human CYB5R2 Protein, GST-tagged | +Inquiry |
CYB5R2-1363R | Recombinant Rat CYB5R2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CYB5R2-4126M | Recombinant Mouse CYB5R2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYB5R2-7143HCL | Recombinant Human CYB5R2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYB5R2 Products
Required fields are marked with *
My Review for All CYB5R2 Products
Required fields are marked with *