Recombinant Human CYB5R2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CYB5R2-662H
Product Overview : CYB5R2 MS Standard C13 and N15-labeled recombinant protein (NP_057313) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene belongs to the flavoprotein pyridine nucleotide cytochrome reductase family of proteins. Cytochrome b-type NAD(P)H oxidoreductases are implicated in many processes including cholesterol biosynthesis, fatty acid desaturation and elongation, and respiratory burst in neutrophils and macrophages. Cytochrome b5 reductases have soluble and membrane-bound forms that are the product of alternative splicing. In animal cells, the membrane-bound form binds to the endoplasmic reticulum, where it is a member of a fatty acid desaturation complex. Alternative splicing results in multiple transcript variants.
Molecular Mass : 21.54 kDa
AA Sequence : MNSRRREPITLQDPEAKYPLPLIEKEKISHNTRRFRFGLPSPDHVLGLPVGNYVQLLAKIDNELVVRAYTPVSSDDDRGFVDLIIKIYFKNVHPQYPEGGKMTQYLENMKIGETIFFRGPRGRLFYHGPGNLGIRPDQTSEPKKTLADHLGMIAGGTGITPMLQLIRHITKDPSDRTRMSLIFANQVSSCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CYB5R2 cytochrome b5 reductase 2 [ Homo sapiens (human) ]
Official Symbol CYB5R2
Synonyms CYB5R2; cytochrome b5 reductase 2; NADH-cytochrome b5 reductase 2; cytochrome b5 reductase b5R.2; B5R.2;
Gene ID 51700
mRNA Refseq NM_016229
Protein Refseq NP_057313
MIM 608342
UniProt ID Q6BCY4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CYB5R2 Products

Required fields are marked with *

My Review for All CYB5R2 Products

Required fields are marked with *

0
cart-icon
0
compare icon