Recombinant Human CYB5R2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CYB5R2-662H |
Product Overview : | CYB5R2 MS Standard C13 and N15-labeled recombinant protein (NP_057313) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene belongs to the flavoprotein pyridine nucleotide cytochrome reductase family of proteins. Cytochrome b-type NAD(P)H oxidoreductases are implicated in many processes including cholesterol biosynthesis, fatty acid desaturation and elongation, and respiratory burst in neutrophils and macrophages. Cytochrome b5 reductases have soluble and membrane-bound forms that are the product of alternative splicing. In animal cells, the membrane-bound form binds to the endoplasmic reticulum, where it is a member of a fatty acid desaturation complex. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 21.54 kDa |
AA Sequence : | MNSRRREPITLQDPEAKYPLPLIEKEKISHNTRRFRFGLPSPDHVLGLPVGNYVQLLAKIDNELVVRAYTPVSSDDDRGFVDLIIKIYFKNVHPQYPEGGKMTQYLENMKIGETIFFRGPRGRLFYHGPGNLGIRPDQTSEPKKTLADHLGMIAGGTGITPMLQLIRHITKDPSDRTRMSLIFANQVSSCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CYB5R2 cytochrome b5 reductase 2 [ Homo sapiens (human) ] |
Official Symbol | CYB5R2 |
Synonyms | CYB5R2; cytochrome b5 reductase 2; NADH-cytochrome b5 reductase 2; cytochrome b5 reductase b5R.2; B5R.2; |
Gene ID | 51700 |
mRNA Refseq | NM_016229 |
Protein Refseq | NP_057313 |
MIM | 608342 |
UniProt ID | Q6BCY4 |
◆ Recombinant Proteins | ||
CYB5R2-4338Z | Recombinant Zebrafish CYB5R2 | +Inquiry |
CYB5R2-662H | Recombinant Human CYB5R2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CYB5R2-1704R | Recombinant Rat CYB5R2 Protein | +Inquiry |
CYB5R2-4126M | Recombinant Mouse CYB5R2 Protein | +Inquiry |
CYB5R2-2113M | Recombinant Mouse CYB5R2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYB5R2-7143HCL | Recombinant Human CYB5R2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYB5R2 Products
Required fields are marked with *
My Review for All CYB5R2 Products
Required fields are marked with *
0
Inquiry Basket