Recombinant Human cyclin E1 protein, His tagged
Cat.No. : | CCNE1-001H |
Product Overview : | Recombinant Human cyclin E1 protein (16-143 aa) with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 16-143 aa |
Description : | The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK2, whose activity is required for cell cycle G1/S transition. This protein accumulates at the G1-S phase boundary and is degraded as cells progress through S phase. Overexpression of this gene has been observed in many tumors, which results in chromosome instability, and thus may contribute to tumorigenesis. This protein was found to associate with, and be involved in, the phosphorylation of NPAT protein (nuclear protein mapped to the ATM locus), which participates in cell-cycle regulated histone gene expression and plays a critical role in promoting cell-cycle progression in the absence of pRB. |
Molecular Mass : | 14.7 kDa |
AA Sequence : | MKEDGGAEFSARSRKRKANVTVFLQDPDEEMAKIDRTARDQCGSQPWDNNAVCADPCSLIPTPDKEDDDRVYPNSTCKPRIIAPSRGSPLPVLSWANREEVWKIMLNKEKTYLRDQHFLEQHPLLQPKHHHHHHHH |
Endotoxin : | < 2 EU/μg by LAL. |
Purity : | > 65 % by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4 |
Concentration : | 0.2 mg/mL |
Gene Name | CCNE1 cyclin E1 [ Homo sapiens (human) ] |
Official Symbol | CCNE1 |
Synonyms | CCNE1; cyclin E1; CCNE; G1/S-specific cyclin-E1; cyclin Es; cyclin Et |
Gene ID | 898 |
mRNA Refseq | NM_001238 |
Protein Refseq | NP_001229 |
MIM | 123837 |
UniProt ID | P24864 |
◆ Recombinant Proteins | ||
CCNE1-2971HF | Recombinant Full Length Human CCNE1 Protein, GST-tagged | +Inquiry |
CCNE1-3075H | Recombinant Human CCNE1 protein, His-tagged | +Inquiry |
CCNE1-31090TH | Recombinant Human Human CCNE1 | +Inquiry |
CCNE1-001H | Recombinant Human cyclin E1 protein, His tagged | +Inquiry |
CCNE1-3011C | Recombinant Chicken CCNE1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCNE1-666HCL | Recombinant Human CCNE1 cell lysate | +Inquiry |
CCNE1-001MCL | Recombinant Mouse CCNE1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCNE1 Products
Required fields are marked with *
My Review for All CCNE1 Products
Required fields are marked with *
0
Inquiry Basket