Recombinant Human CYFIP1 Protein, GST-tagged

Cat.No. : CYFIP1-2228H
Product Overview : Human CYFIP1 partial ORF ( NP_055423.1, 735 a.a. - 819 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein that regulates cytoskeletal dynamics and protein translation. The encoded protein is a component of the WAVE regulatory complex (WRC), which promotes actin polymerization.This protein also interacts with the Fragile X mental retardation protein (FMRP) and translation initiation factor 4E to inhibit protein translation. A large chromosomal deletion including this gene is associated with increased risk of schizophrenia and epilepsy in human patients. Reduced expression of this gene has been observed in various human cancers and the encoded protein may inhibit tumor invasion. [provided by RefSeq, May 2017]
Molecular Mass : 35.09 kDa
AA Sequence : GATIHLPPSNRYETLLKQRHVQLLGRSIDLNRLITQRVSAAMYKSLELAIGRFESEDLTSIVELDGLLEINRMTHKLLSRYLTLD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CYFIP1 cytoplasmic FMR1 interacting protein 1 [ Homo sapiens ]
Official Symbol CYFIP1
Synonyms CYFIP1; cytoplasmic FMR1 interacting protein 1; cytoplasmic FMR1-interacting protein 1; cytoplasmic FMRP interacting protein 1; KIAA0068; P140SRA 1; selective hybridizing clone; SHYC; sra-1; specifically Rac1-associated protein 1; SRA1; P140SRA-1; FLJ45151;
Gene ID 23191
mRNA Refseq NM_001033028
Protein Refseq NP_001028200
MIM 606322
UniProt ID Q7L576

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CYFIP1 Products

Required fields are marked with *

My Review for All CYFIP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon