Recombinant Human CYFIP1 Protein, GST-tagged
Cat.No. : | CYFIP1-2228H |
Product Overview : | Human CYFIP1 partial ORF ( NP_055423.1, 735 a.a. - 819 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein that regulates cytoskeletal dynamics and protein translation. The encoded protein is a component of the WAVE regulatory complex (WRC), which promotes actin polymerization.This protein also interacts with the Fragile X mental retardation protein (FMRP) and translation initiation factor 4E to inhibit protein translation. A large chromosomal deletion including this gene is associated with increased risk of schizophrenia and epilepsy in human patients. Reduced expression of this gene has been observed in various human cancers and the encoded protein may inhibit tumor invasion. [provided by RefSeq, May 2017] |
Molecular Mass : | 35.09 kDa |
AA Sequence : | GATIHLPPSNRYETLLKQRHVQLLGRSIDLNRLITQRVSAAMYKSLELAIGRFESEDLTSIVELDGLLEINRMTHKLLSRYLTLD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CYFIP1 cytoplasmic FMR1 interacting protein 1 [ Homo sapiens ] |
Official Symbol | CYFIP1 |
Synonyms | CYFIP1; cytoplasmic FMR1 interacting protein 1; cytoplasmic FMR1-interacting protein 1; cytoplasmic FMRP interacting protein 1; KIAA0068; P140SRA 1; selective hybridizing clone; SHYC; sra-1; specifically Rac1-associated protein 1; SRA1; P140SRA-1; FLJ45151; |
Gene ID | 23191 |
mRNA Refseq | NM_001033028 |
Protein Refseq | NP_001028200 |
MIM | 606322 |
UniProt ID | Q7L576 |
◆ Recombinant Proteins | ||
CYFIP1-12029Z | Recombinant Zebrafish CYFIP1 | +Inquiry |
CYFIP1-2121M | Recombinant Mouse CYFIP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CYFIP1-2228H | Recombinant Human CYFIP1 Protein, GST-tagged | +Inquiry |
CYFIP1-4137M | Recombinant Mouse CYFIP1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYFIP1 Products
Required fields are marked with *
My Review for All CYFIP1 Products
Required fields are marked with *