Recombinant Human CYGB, His-tagged
| Cat.No. : | CYGB-26694TH |
| Product Overview : | Recombinant full length Human Cytoglobin with an N terminal His tag; 210aa, 23.5kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 190 amino acids |
| Description : | Cytoglobin is a ubiquitously expressed hexacoordinate hemoglobin that may facilitate diffusion of oxygen through tissues, scavenge nitric oxide or other reactive oxygen species, or serve a protective function during oxidative stress (Trent and Hargrove, 2002 |
| Conjugation : | HIS |
| Molecular Weight : | 23.500kDa inclusive of tags |
| Tissue specificity : | Ubiquitously expressed. Highest expression in heart, stomach, bladder and small intestine. |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, pH 8.0 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMEKVPGEMEIERRERSEELSEAERKAVQAMWARLYASCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP |
| Sequence Similarities : | Belongs to the globin family. |
| Gene Name | CYGB cytoglobin [ Homo sapiens ] |
| Official Symbol | CYGB |
| Synonyms | CYGB; cytoglobin; HGB; histoglobin; STAP; stellate cell activation associated protein; |
| Gene ID | 114757 |
| mRNA Refseq | NM_134268 |
| Protein Refseq | NP_599030 |
| MIM | 608759 |
| Uniprot ID | Q8WWM9 |
| Chromosome Location | 17q25 |
| Function | heme binding; metal ion binding; oxygen binding; oxygen transporter activity; peroxidase activity; |
| ◆ Recombinant Proteins | ||
| CYGB-1132R | Recombinant Rhesus monkey CYGB Protein, His-tagged | +Inquiry |
| CYGB-957R | Recombinant Rhesus Macaque CYGB Protein, His (Fc)-Avi-tagged | +Inquiry |
| CYGB-2783H | Recombinant Human CYGB protein, His-SUMO-tagged | +Inquiry |
| CYGB-7803H | Recombinant Human CYGB | +Inquiry |
| CYGB-1711R | Recombinant Rat CYGB Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CYGB-7134HCL | Recombinant Human CYGB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYGB Products
Required fields are marked with *
My Review for All CYGB Products
Required fields are marked with *



