Recombinant Human CYGB, His-tagged

Cat.No. : CYGB-26694TH
Product Overview : Recombinant full length Human Cytoglobin with an N terminal His tag; 210aa, 23.5kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 190 amino acids
Description : Cytoglobin is a ubiquitously expressed hexacoordinate hemoglobin that may facilitate diffusion of oxygen through tissues, scavenge nitric oxide or other reactive oxygen species, or serve a protective function during oxidative stress (Trent and Hargrove, 2002
Conjugation : HIS
Molecular Weight : 23.500kDa inclusive of tags
Tissue specificity : Ubiquitously expressed. Highest expression in heart, stomach, bladder and small intestine.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMEKVPGEMEIERRERSEELSEAERKAVQAMWARLYASCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP
Sequence Similarities : Belongs to the globin family.
Gene Name CYGB cytoglobin [ Homo sapiens ]
Official Symbol CYGB
Synonyms CYGB; cytoglobin; HGB; histoglobin; STAP; stellate cell activation associated protein;
Gene ID 114757
mRNA Refseq NM_134268
Protein Refseq NP_599030
MIM 608759
Uniprot ID Q8WWM9
Chromosome Location 17q25
Function heme binding; metal ion binding; oxygen binding; oxygen transporter activity; peroxidase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CYGB Products

Required fields are marked with *

My Review for All CYGB Products

Required fields are marked with *

0
cart-icon