Recombinant Human CYP11B1 protein, His-tagged

Cat.No. : CYP11B1-3808H
Product Overview : Recombinant Human CYP11B1 protein(202-575 aa), fused to His tag, was expressed in E. coli.
Availability September 01, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 202-575 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : CRNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILRPSMFPLLTFRAIN
Purity : 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name CYP11B1 cytochrome P450, family 11, subfamily B, polypeptide 1 [ Homo sapiens ]
Official Symbol CYP11B1
Synonyms CYP11B1; cytochrome P450, family 11, subfamily B, polypeptide 1; CYP11B, cytochrome P450, subfamily XIB (steroid 11 beta hydroxylase), polypeptide 1; cytochrome P450 11B1, mitochondrial; CPN1; FHI; P450C11; CYPXIB1; cytochrome P450C11; cytochrome P-450c11; cytochrome p450 XIB1; steroid 11-beta-hydroxylase; steroid 11-beta-monooxygenase; cytochrome P450, subfamily XIB (steroid 11-beta-hydroxylase), polypeptide 1; CYP11B; FLJ36771; DKFZp686B05283;
Gene ID 1584
mRNA Refseq NM_000497
Protein Refseq NP_000488
MIM 610613
UniProt ID P15538

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CYP11B1 Products

Required fields are marked with *

My Review for All CYP11B1 Products

Required fields are marked with *

0
cart-icon
0
compare icon