Recombinant Human CYP11B1 protein, His-tagged
Cat.No. : | CYP11B1-3808H |
Product Overview : | Recombinant Human CYP11B1 protein(202-575 aa), fused to His tag, was expressed in E. coli. |
Availability | September 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 202-575 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | CRNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILRPSMFPLLTFRAIN |
Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CYP11B1 cytochrome P450, family 11, subfamily B, polypeptide 1 [ Homo sapiens ] |
Official Symbol | CYP11B1 |
Synonyms | CYP11B1; cytochrome P450, family 11, subfamily B, polypeptide 1; CYP11B, cytochrome P450, subfamily XIB (steroid 11 beta hydroxylase), polypeptide 1; cytochrome P450 11B1, mitochondrial; CPN1; FHI; P450C11; CYPXIB1; cytochrome P450C11; cytochrome P-450c11; cytochrome p450 XIB1; steroid 11-beta-hydroxylase; steroid 11-beta-monooxygenase; cytochrome P450, subfamily XIB (steroid 11-beta-hydroxylase), polypeptide 1; CYP11B; FLJ36771; DKFZp686B05283; |
Gene ID | 1584 |
mRNA Refseq | NM_000497 |
Protein Refseq | NP_000488 |
MIM | 610613 |
UniProt ID | P15538 |
◆ Recombinant Proteins | ||
Cyp11b1-8080R | Recombinant Rat Cyp11b1 protein, His & T7-tagged | +Inquiry |
CYP11B1-2396H | Recombinant Human CYP11B1 Protein (25-503 aa), His-SUMO-Myc-tagged | +Inquiry |
CYP11B1-1133R | Recombinant Rhesus monkey CYP11B1 Protein, His-tagged | +Inquiry |
Cyp11b1-889M | Recombinant Mouse Cyp11b1 Protein, His&SUMO-tagged | +Inquiry |
CYP11B1-2292HF | Recombinant Full Length Human CYP11B1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYP11B1-7130HCL | Recombinant Human CYP11B1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYP11B1 Products
Required fields are marked with *
My Review for All CYP11B1 Products
Required fields are marked with *