Recombinant Human CYP24A1, GST-tagged
| Cat.No. : | CYP24A1-251H |
| Product Overview : | Recombinant Human CYP24A1(415 a.a. - 514 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein initiates the degradation of 1,25-dihydroxyvitamin D3, the physiologically active form of vitamin D3, by hydroxylation of the side chain. In regulating the level of vitamin D3, this enzyme plays a role in calcium homeostasis and the vitamin D endocrine system. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | LMLNTQVLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIVRKYDIQATD NEPVEMLHSGTLVPSRELPIAFCQR |
| Applications : | ELISA; WB-Re; AP; Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80oC. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CYP24A1 cytochrome P450, family 24, subfamily A, polypeptide 1 [ Homo sapiens (human) ] |
| Official Symbol | CYP24A1 |
| Synonyms | CYP24A1; cytochrome P450, family 24, subfamily A, polypeptide 1; CYP24, cytochrome P450, subfamily XXIV (vitamin D 24 hydroxylase); 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; CP24; P450 CC24; 24-OHase; cytochrome P450 24A1; cytochrome P450-CC24; vitamin D 24-hydroxylase; exo-mitochondrial protein; vitamin D(3) 24-hydroxylase; 1,25-@dihydroxyvitamin D3 24-hydroxylase; cytochrome P450, subfamily XXIV (vitamin D 24-hydroxylase); HCAI; CYP24; P450-CC24; MGC126273; MGC126274 |
| Gene ID | 1591 |
| mRNA Refseq | NM_000782 |
| Protein Refseq | NP_000773 |
| MIM | 126065 |
| UniProt ID | Q07973 |
| Chromosome Location | 20q13 |
| Pathway | Biological oxidations; Cytochrome P450 - arranged by substrate type; Defective CYP11B1 causes Adrenal hyperplasia 4 (AH4) |
| Function | 1-alpha,25-dihydroxyvitamin D3 24-hydroxylase activity; 25-hydroxycholecalciferol-24-hydroxylase activity; heme binding |
| ◆ Recombinant Proteins | ||
| CYP24A1-1719R | Recombinant Rat CYP24A1 Protein | +Inquiry |
| CYP24A1-11768H | Recombinant Human CYP24A1, His-tagged | +Inquiry |
| CYP24A1-5569Z | Recombinant Zebrafish CYP24A1 | +Inquiry |
| CYP24A1-1914H | Recombinant Human CYP24A1 Protein (Gln37-Gly250), N-His tagged | +Inquiry |
| Cyp24a1-4608M | Recombinant Mouse Cyp24a1 protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CYP24A1-7122HCL | Recombinant Human CYP24A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYP24A1 Products
Required fields are marked with *
My Review for All CYP24A1 Products
Required fields are marked with *
