Recombinant Human CYP2C19 protein, His&Myc-tagged

Cat.No. : CYP2C19-2793H
Product Overview : Recombinant Human CYP2C19 protein(P33261)(26-490aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Myc
Protein Length : 26-490aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 60.6 kDa
AA Sequence : RGKLPPGPTPLPVIGNILQIDIKDVSKSLTNLSKIYGPVFTLYFGLERMVVLHGYEVVKEALIDLGEEFSGRGHFPLAERANRGFGIVFSNGKRWKEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKASPCDPTFILGCAPCNVICSIIFQKRFDYKDQQFLNLMEKLNENIRIVSTPWIQICNNFPTIIDYFPGTHNKLLKNLAFMESDILEKVKEHQESMDINNPRDFIDCFLIKMEKEKQNQQSEFTIENLVITAADLLGAGTETTSTTLRYALLLLLKHPEVTAKVQEEIERVVGRNRSPCMQDRGHMPYTDAVVHEVQRYIDLIPTSLPHAVTCDVKFRNYLIPKGTTILTSLTSVLHDNKEFPNPEMFDPRHFLDEGGNFKKSNYFMPFSAGKRICVGEGLARMELFLFLTFILQNFNLKSLIDPKDLDTTPVVNGFASVPPFYQLCFIPV
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name CYP2C19 cytochrome P450, family 2, subfamily C, polypeptide 19 [ Homo sapiens ]
Official Symbol CYP2C19
Synonyms CYP2C19; cytochrome P450, family 2, subfamily C, polypeptide 19; CYP2C, cytochrome P450, subfamily IIC (mephenytoin 4 hydroxylase), polypeptide 19; cytochrome P450 2C19; CPCJ; P450IIC19; CYPIIC17; CYPIIC19; cytochrome P450-11A; cytochrome P450-254C; cytochrome P-450 II C; microsomal monooxygenase; xenobiotic monooxygenase; mephenytoin 4-hydroxylase; S-mephenytoin 4-hydroxylase; (R)-limonene 6-monooxygenase; (S)-limonene 6-monooxygenase; (S)-limonene 7-monooxygenase; flavoprotein-linked monooxygenase; cytochrome P450, subfamily IIC (mephenytoin 4-hydroxylase), polypeptide 19; CYP2C; P450C2C;
Gene ID 1557
mRNA Refseq NM_000769
Protein Refseq NP_000760
MIM 124020
UniProt ID P33261

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CYP2C19 Products

Required fields are marked with *

My Review for All CYP2C19 Products

Required fields are marked with *

0
cart-icon