Recombinant Human CYP2F1 Protein, GST-tagged
Cat.No. : | CYP2F1-2267H |
Product Overview : | Human CYP2F1 partial ORF ( NP_000765, 191 a.a. - 290 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to dehydrogenate 3-methylindole, an endogenous toxin derived from the fermentation of tryptophan, as well as xenobiotic substrates such as naphthalene and ethoxycoumarin. This gene is part of a large cluster of cytochrome P450 genes from the CYP2A, CYP2B and CYP2F subfamilies on chromosome 19q. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | DDERLLTIIRLINDNFQIMSSPWGELYDIFPSLLDWVPGPHQRIFQNFKCLRDLIAHSVHDHQASLDPRSPRDFIQCFLTKMAEEKEDPLSHFHMDTLLM |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CYP2F1 cytochrome P450, family 2, subfamily F, polypeptide 1 [ Homo sapiens ] |
Official Symbol | CYP2F1 |
Synonyms | CYPIIF1; Cytochrome P450 2F1; cytochrome P450, family 2, subfamily F, polypeptide 1; EC=1.14.14.1; flavoprotein-linked monooxygenase; CYPIIF1; microsomal monooxygenase; EC 1.14.14.1; xenobiotic monooxygenase |
Gene ID | 1572 |
mRNA Refseq | NM_000774.3 |
Protein Refseq | NP_000765.2 |
MIM | 124070 |
UniProt ID | P24903 |
◆ Recombinant Proteins | ||
CYP2F1-139H | Recombinant Human CYP2F1 Protein, His-tagged | +Inquiry |
CYP2F1-1155R | Recombinant Rhesus monkey CYP2F1 Protein, His-tagged | +Inquiry |
CYP2F1-2267H | Recombinant Human CYP2F1 Protein, GST-tagged | +Inquiry |
CYP2F1-11776H | Recombinant Human CYP2F1, GST-tagged | +Inquiry |
CYP2F1-980R | Recombinant Rhesus Macaque CYP2F1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYP2F1 Products
Required fields are marked with *
My Review for All CYP2F1 Products
Required fields are marked with *
0
Inquiry Basket