Recombinant Human CYP2F1 Protein, GST-tagged

Cat.No. : CYP2F1-2267H
Product Overview : Human CYP2F1 partial ORF ( NP_000765, 191 a.a. - 290 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to dehydrogenate 3-methylindole, an endogenous toxin derived from the fermentation of tryptophan, as well as xenobiotic substrates such as naphthalene and ethoxycoumarin. This gene is part of a large cluster of cytochrome P450 genes from the CYP2A, CYP2B and CYP2F subfamilies on chromosome 19q. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.74 kDa
AA Sequence : DDERLLTIIRLINDNFQIMSSPWGELYDIFPSLLDWVPGPHQRIFQNFKCLRDLIAHSVHDHQASLDPRSPRDFIQCFLTKMAEEKEDPLSHFHMDTLLM
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CYP2F1 cytochrome P450, family 2, subfamily F, polypeptide 1 [ Homo sapiens ]
Official Symbol CYP2F1
Synonyms CYPIIF1; Cytochrome P450 2F1; cytochrome P450, family 2, subfamily F, polypeptide 1; EC=1.14.14.1; flavoprotein-linked monooxygenase; CYPIIF1; microsomal monooxygenase; EC 1.14.14.1; xenobiotic monooxygenase
Gene ID 1572
mRNA Refseq NM_000774.3
Protein Refseq NP_000765.2
MIM 124070
UniProt ID P24903

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CYP2F1 Products

Required fields are marked with *

My Review for All CYP2F1 Products

Required fields are marked with *

0
cart-icon
0
compare icon