Recombinant Human CYP2U1 protein, GST-tagged
Cat.No. : | CYP2U1-6744H |
Product Overview : | Recombinant Human CYP2U1 protein(1-59 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-59 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | MSSPGPSQPPAEDPPWPARLLRAPLGLLRLDPSGGALLLCGLVALLGWSWLRRRRARGI |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | CYP2U1 cytochrome P450, family 2, subfamily U, polypeptide 1 [ Homo sapiens ] |
Official Symbol | CYP2U1 |
Synonyms | CYP2U1; cytochrome P450, family 2, subfamily U, polypeptide 1; cytochrome P450 2U1; P450TEC; |
Gene ID | 113612 |
mRNA Refseq | NM_183075 |
Protein Refseq | NP_898898 |
MIM | 610670 |
UniProt ID | Q7Z449 |
◆ Recombinant Proteins | ||
RFL26258RF | Recombinant Full Length Rat Cytochrome P450 2U1(Cyp2U1) Protein, His-Tagged | +Inquiry |
RFL29322MF | Recombinant Full Length Mouse Cytochrome P450 2U1(Cyp2U1) Protein, His-Tagged | +Inquiry |
CYP2U1-6744H | Recombinant Human CYP2U1 protein, GST-tagged | +Inquiry |
CYP2U1-2270H | Recombinant Human CYP2U1 Protein, GST-tagged | +Inquiry |
RFL15545HF | Recombinant Full Length Human Cytochrome P450 2U1(Cyp2U1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYP2U1-435HCL | Recombinant Human CYP2U1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYP2U1 Products
Required fields are marked with *
My Review for All CYP2U1 Products
Required fields are marked with *