Recombinant Human CYP39A1 protein, His-tagged
| Cat.No. : | CYP39A1-3413H |
| Product Overview : | Recombinant Human CYP39A1 protein(18-274 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 23, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 18-274 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | FLLLQPKNLRRPPCIKGWIPWIGVGFEFGKAPLEFIEKARIKYGPIFTVFAMGNRMTFVTEEEGINVFLKSKKVDFELAVQNIVYRTASIPKNVFLALHEKLYIMLKGKMGTVNLHQFTGQLTEELHEQLENLGTHGTMDLNNLVRHLLYPVTVNMLFNKSLFSTNKKKIKEFHQYFQVYDEDFEYGSQLPECLLRNWSKSKKWFLELFEKNIPDIKACKSAKDNSMTLLQATLDIVETETSKENSPNYGLLLLWAS |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CYP39A1 cytochrome P450, family 39, subfamily A, polypeptide 1 [ Homo sapiens ] |
| Official Symbol | CYP39A1 |
| Synonyms | CYP39A1; cytochrome P450, family 39, subfamily A, polypeptide 1; cytochrome P450, subfamily XXXIX (oxysterol 7 alpha hydroxylase), polypeptide 1; 24-hydroxycholesterol 7-alpha-hydroxylase; hCYP39A1; cytochrome P450 39A1; oxysterol 7alpha-hydroxylase; oxysterol 7-alpha-hydroxylase; cytochrome P450, subfamily XXXIX (oxysterol 7 alpha-hydroxylase), polypeptide 1; |
| Gene ID | 51302 |
| mRNA Refseq | NM_016593 |
| Protein Refseq | NP_057677 |
| MIM | 605994 |
| UniProt ID | Q9NYL5 |
| ◆ Recombinant Proteins | ||
| CYP39A1-2398HF | Recombinant Full Length Human CYP39A1 Protein, GST-tagged | +Inquiry |
| CYP39A1-982R | Recombinant Rhesus Macaque CYP39A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CYP39A1-1157R | Recombinant Rhesus monkey CYP39A1 Protein, His-tagged | +Inquiry |
| CYP39A1-3295Z | Recombinant Zebrafish CYP39A1 | +Inquiry |
| CYP39A1-2272H | Recombinant Human CYP39A1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYP39A1 Products
Required fields are marked with *
My Review for All CYP39A1 Products
Required fields are marked with *
