Recombinant Human CYP4F22 Protein, GST-tagged
| Cat.No. : | CYP4F22-2284H |
| Product Overview : | Human CYP4F22 full-length ORF ( AAH69351.1, 1 a.a. - 531 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This gene is part of a cluster of cytochrome P450 genes on chromosome 19 and encodes an enzyme thought to play a role in the 12(R)-lipoxygenase pathway. Mutations in this gene are the cause of ichthyosis lamellar type 3. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 88.4 kDa |
| AA Sequence : | MLPITDRLLHLLGLEKTAFRIYAVSTLLLFLLFFLFRLLLRFLRLCRSFYITCRRLRCFPQPPRRNWLLGHLGMYLPNEAGLQDEKKVLDNMHHVLLVWMGPVLPLLVLVHPDYIKPLLGASAAIAPKDDLFYGFLKPWLGDGLLLSKGDKWSRHRRLLTPAFHFDILKPYMKIFNQSADIMHAKWRHLAEGSAVSLDMFEHISLMTLDSLQKCVFSYNSNCQEKMSDYISAIIELSALSVRRQYRLHHYLDFIYYRSADGRRFRQACDMVHHFTTEVIQERRRALRQQGAEAWLKAKQGKTLDFIDVLLLARDEDGKELSDEDIRAEADTFMFEGHDTTSSGISWMLFNLAKYPEYQEKCREEIQEVMKGRELEELEWDDLTQLPFTTMCIKESLRQYPPVTLVSRQCTEDIKLPDGRIIPKGIICLVSIYGTHHNPTVWPDSKVYNPYRFDPDNPQQRSPLAYVPFSAGPRNCIGQSFAMAELRVVVALTLLRFRLSVDRTRKVRRKPELILRTENGLWLKVEPLPPRA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 [ Homo sapiens ] |
| Official Symbol | CYP4F22 |
| Synonyms | CYP4F22; cytochrome P450, family 4, subfamily F, polypeptide 22; cytochrome P450 4F22; FLJ39501; cytochrome P450, family 2, subfamily E, polypeptide 2 homolog; LI3; |
| Gene ID | 126410 |
| mRNA Refseq | NM_173483 |
| Protein Refseq | NP_775754 |
| MIM | 611495 |
| UniProt ID | Q6NT55 |
| ◆ Recombinant Proteins | ||
| CYP4F22-2284H | Recombinant Human CYP4F22 Protein, GST-tagged | +Inquiry |
| CYP4F22-2444HF | Recombinant Full Length Human CYP4F22 Protein, GST-tagged | +Inquiry |
| CYP4F22-1163R | Recombinant Rhesus monkey CYP4F22 Protein, His-tagged | +Inquiry |
| CYP4F22-988R | Recombinant Rhesus Macaque CYP4F22 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CYP4F22-5879H | Recombinant Human CYP4F22 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CYP4F22-7101HCL | Recombinant Human CYP4F22 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYP4F22 Products
Required fields are marked with *
My Review for All CYP4F22 Products
Required fields are marked with *
