Recombinant Human CYR61 protein, GST-tagged

Cat.No. : CYR61-3656H
Product Overview : Recombinant Human CYR61 protein(165-239 aa), fused to GST tag, was expressed in E. coli.
Availability November 05, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 165-239 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : EDSIKDPMEDQDGLLGKELGFDASEVELTRNNELIAVGKGSSLKRLPVFGMEPRILYNPLQGQKCIVQTTSWSQC
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name CYR61 cysteine-rich, angiogenic inducer, 61 [ Homo sapiens ]
Official Symbol CYR61
Synonyms CYR61; cysteine-rich, angiogenic inducer, 61; IGFBP10; protein CYR61; CCN1; GIG1; IBP-10; IGFBP-10; CCN family member 1; IGF-binding protein 10; cysteine-rich, anigogenic inducer, 61; cysteine-rich heparin-binding protein 61; insulin-like growth factor-binding protein 10;
Gene ID 3491
mRNA Refseq NM_001554
Protein Refseq NP_001545
MIM 602369
UniProt ID O00622

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CYR61 Products

Required fields are marked with *

My Review for All CYR61 Products

Required fields are marked with *

0
cart-icon
0
compare icon