Recombinant Human CYR61 protein, GST-tagged
| Cat.No. : | CYR61-3656H |
| Product Overview : | Recombinant Human CYR61 protein(165-239 aa), fused to GST tag, was expressed in E. coli. |
| Availability | December 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 165-239 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | EDSIKDPMEDQDGLLGKELGFDASEVELTRNNELIAVGKGSSLKRLPVFGMEPRILYNPLQGQKCIVQTTSWSQC |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CYR61 cysteine-rich, angiogenic inducer, 61 [ Homo sapiens ] |
| Official Symbol | CYR61 |
| Synonyms | CYR61; cysteine-rich, angiogenic inducer, 61; IGFBP10; protein CYR61; CCN1; GIG1; IBP-10; IGFBP-10; CCN family member 1; IGF-binding protein 10; cysteine-rich, anigogenic inducer, 61; cysteine-rich heparin-binding protein 61; insulin-like growth factor-binding protein 10; |
| Gene ID | 3491 |
| mRNA Refseq | NM_001554 |
| Protein Refseq | NP_001545 |
| MIM | 602369 |
| UniProt ID | O00622 |
| ◆ Recombinant Proteins | ||
| CYR61-2295H | Recombinant Human CYR61 Protein, GST-tagged | +Inquiry |
| CYR61-1374M | Recombinant Mouse CYR61 Protein (25-379 aa), His-tagged | +Inquiry |
| Cyr61-2798M | Recombinant Mouse Cyr61 protein, His-tagged | +Inquiry |
| CYR61-4246M | Recombinant Mouse CYR61 Protein | +Inquiry |
| CYR61-2797H | Recombinant Human CYR61 protein, His-SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CYR61-7097HCL | Recombinant Human CYR61 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYR61 Products
Required fields are marked with *
My Review for All CYR61 Products
Required fields are marked with *
