Recombinant Human CYTL1 protein, hFc-tagged

• Cat.No.: CYTL1-0381H
• Product Overview: Recombinant Human CYTL1 protein(23-136aa)(Q9NRR1), fused to C-terminal hFc tag, was expressed in Mammalian cell.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Fc
• Protein Length: 23-136aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 40.8 kDa
• AA Sequence: TPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: CYTL1 cytokine like 1 [ Homo sapiens (human) ]
• Official Symbol: CYTL1
• Synonyms: C17; C4orf4
• Gene ID: 54360
• mRNA Refseq: NM_018659
• Protein Refseq: NP_061129
• MIM: 607930
• UniProt ID: Q9NRR1