Recombinant Human CYTL1 Protein, GST-tagged
Cat.No. : | CYTL1-2307H |
Product Overview : | Human CYTL1 full-length ORF ( AAH31391, 1 a.a. - 136 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | C17 is a cytokine-like protein specifically expressed in bone marrow and cord blood mononuclear cells that bear the CD34 (MIM 142230) surface marker (Liu et al., 2000 [PubMed 10857752]).[supplied by OMIM, Mar 2008] |
Molecular Mass : | 40.7 kDa |
AA Sequence : | MRTPGPLPVLLLLLAGAPAARPTPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTALPDRQR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CYTL1 cytokine like 1 [ Homo sapiens (human) ] |
Official Symbol | CYTL1 |
Synonyms | CYTL1; cytokine like 1; Cytokine Like 1; C4orf4; Cytokine-Like Protein C17; Cytokine-Like Protein 1; Cytokine-Like 1; Protein C17; C17; cytokine-like protein 1; cytokine-like protein C17 |
Gene ID | 54360 |
mRNA Refseq | NM_018659 |
Protein Refseq | NP_061129 |
MIM | 607930 |
UniProt ID | Q9NRR1 |
◆ Recombinant Proteins | ||
CYTL1-1171R | Recombinant Rhesus monkey CYTL1 Protein, His-tagged | +Inquiry |
CYTL1-0381H | Recombinant Human CYTL1 protein, hFc-tagged | +Inquiry |
CYTL1-711H | Recombinant Human CYTL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CYTL1-1442H | Recombinant Human CYTL1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CYTL1-996R | Recombinant Rhesus Macaque CYTL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYTL1-7091HCL | Recombinant Human CYTL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYTL1 Products
Required fields are marked with *
My Review for All CYTL1 Products
Required fields are marked with *