Recombinant Human CYTL1 Protein, GST-tagged
| Cat.No. : | CYTL1-2307H |
| Product Overview : | Human CYTL1 full-length ORF ( AAH31391, 1 a.a. - 136 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | C17 is a cytokine-like protein specifically expressed in bone marrow and cord blood mononuclear cells that bear the CD34 (MIM 142230) surface marker (Liu et al., 2000 [PubMed 10857752]).[supplied by OMIM, Mar 2008] |
| Molecular Mass : | 40.7 kDa |
| AA Sequence : | MRTPGPLPVLLLLLAGAPAARPTPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTALPDRQR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CYTL1 cytokine like 1 [ Homo sapiens (human) ] |
| Official Symbol | CYTL1 |
| Synonyms | CYTL1; cytokine like 1; Cytokine Like 1; C4orf4; Cytokine-Like Protein C17; Cytokine-Like Protein 1; Cytokine-Like 1; Protein C17; C17; cytokine-like protein 1; cytokine-like protein C17 |
| Gene ID | 54360 |
| mRNA Refseq | NM_018659 |
| Protein Refseq | NP_061129 |
| MIM | 607930 |
| UniProt ID | Q9NRR1 |
| ◆ Recombinant Proteins | ||
| CYTL1-182HFL | Active Recombinant Full Length Human CYTL1 Protein, C-Flag-tagged | +Inquiry |
| CYTL1-1303H | Recombinant Human CYTL1 Protein, His-tagged | +Inquiry |
| CYTL1-0381H | Recombinant Human CYTL1 protein, hFc-tagged | +Inquiry |
| CYTL1-996R | Recombinant Rhesus Macaque CYTL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CYTL1-0382H | Recombinant Human CYTL1 protein, His&Myc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CYTL1-7091HCL | Recombinant Human CYTL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYTL1 Products
Required fields are marked with *
My Review for All CYTL1 Products
Required fields are marked with *
