Recombinant Human DACT1 Protein, GST-tagged
Cat.No. : | DACT1-2322H |
Product Overview : | Human DACT1 partial ORF ( NP_057735.2, 738 a.a. - 836 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs to the dapper family, characterized by the presence of PDZ-binding motif at the C-terminus. It interacts with, and positively regulates dishevelled-mediated signaling pathways during development. Depletion of this mRNA from xenopus embryos resulted in loss of notochord and head structures, and mice lacking this gene died shortly after birth from severe posterior malformations. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2012] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | VVDTSEDEQSNYTTNCFGDSESSVSEGEFVGESTTTSDSEESGGLIWSQFVQTLPIQTVTAPDLHNHPAKTFVKIKASHNLKKKILRFRSGSLKLMTTV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DACT1 dapper, antagonist of beta-catenin, homolog 1 (Xenopus laevis) [ Homo sapiens ] |
Official Symbol | DACT1 |
Synonyms | DACT1; dapper, antagonist of beta-catenin, homolog 1 (Xenopus laevis); dapper homolog 1, antagonist of beta catenin (xenopus); dapper homolog 1; DAPPER; DAPPER1; FRODO; HDPR1; THYEX3; heptacellular carcinoma novel gene 3; hepatocellular carcinoma novel gene 3 protein; DPR1; |
Gene ID | 51339 |
mRNA Refseq | NM_001079520 |
Protein Refseq | NP_001072988 |
MIM | 607861 |
UniProt ID | Q9NYF0 |
◆ Recombinant Proteins | ||
DACT1-12757Z | Recombinant Zebrafish DACT1 | +Inquiry |
DACT1-2322H | Recombinant Human DACT1 Protein, GST-tagged | +Inquiry |
DACT1-3483C | Recombinant Chicken DACT1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
DACT1-7084HCL | Recombinant Human DACT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DACT1 Products
Required fields are marked with *
My Review for All DACT1 Products
Required fields are marked with *
0
Inquiry Basket