Recombinant Human DACT1 Protein, GST-tagged

Cat.No. : DACT1-2322H
Product Overview : Human DACT1 partial ORF ( NP_057735.2, 738 a.a. - 836 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene belongs to the dapper family, characterized by the presence of PDZ-binding motif at the C-terminus. It interacts with, and positively regulates dishevelled-mediated signaling pathways during development. Depletion of this mRNA from xenopus embryos resulted in loss of notochord and head structures, and mice lacking this gene died shortly after birth from severe posterior malformations. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2012]
Molecular Mass : 36.63 kDa
AA Sequence : VVDTSEDEQSNYTTNCFGDSESSVSEGEFVGESTTTSDSEESGGLIWSQFVQTLPIQTVTAPDLHNHPAKTFVKIKASHNLKKKILRFRSGSLKLMTTV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DACT1 dapper, antagonist of beta-catenin, homolog 1 (Xenopus laevis) [ Homo sapiens ]
Official Symbol DACT1
Synonyms DACT1; dapper, antagonist of beta-catenin, homolog 1 (Xenopus laevis); dapper homolog 1, antagonist of beta catenin (xenopus); dapper homolog 1; DAPPER; DAPPER1; FRODO; HDPR1; THYEX3; heptacellular carcinoma novel gene 3; hepatocellular carcinoma novel gene 3 protein; DPR1;
Gene ID 51339
mRNA Refseq NM_001079520
Protein Refseq NP_001072988
MIM 607861
UniProt ID Q9NYF0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DACT1 Products

Required fields are marked with *

My Review for All DACT1 Products

Required fields are marked with *

0
cart-icon
0
compare icon