Recombinant Human DAZ4 Protein, GST-tagged
Cat.No. : | DAZ4-2356H |
Product Overview : | Human DAZ4 full-length ORF ( NP_065153.1, 1 a.a. - 390 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). Its expression is restricted to premeiotic germ cells, particularly in spermatogonia. It encodes an RNA-binding protein that is important for spermatogenesis. Four copies of this gene are found on chromosome Y within palindromic duplications; one pair of genes is part of the P2 palindrome and the second pair is part of the P1 palindrome. Each gene contains a 2.4 kb repeat including a 72-bp exon, called the DAZ repeat; the number of DAZ repeats is variable and there are several variations in the sequence of the DAZ repeat. Each copy of the gene also contains a 10.8 kb region that may be amplified; this region includes five exons that encode an RNA recognition motif (RRM) domain. This gene contains two copies of the 10.8 kb repeat. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Feb 2011] |
Molecular Mass : | 70.5 kDa |
AA Sequence : | MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLCARHVQPRPLVVNPPPPPQFQNVWRNPNTETYLQPQITPNPVTQHVQAYSAYPHSPGQVITGCQLLVYNYQEYPTYPDSAFQVTTGYQLPVYNYQPFPAYPRSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQPFPAYPSSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQAFPAYPNSPVQVTTGYQLPVYNYQAFPAYPNSAVQVTTGYQFHVYNYQMPPQCPVGEQRRNLWTEAYKWWYLVCLIQRRD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DAZ4 deleted in azoospermia 4 [ Homo sapiens ] |
Official Symbol | DAZ4 |
Synonyms | DAZ4; deleted in azoospermia 4; deleted in azoospermia protein 4; pDP1680; pDP1681; |
Gene ID | 57135 |
mRNA Refseq | NM_001005375 |
Protein Refseq | NP_001005375 |
UniProt ID | Q86SG3 |
◆ Recombinant Proteins | ||
DAZ4-11835H | Recombinant Human DAZ4, GST-tagged | +Inquiry |
DAZ4-4134H | Recombinant Human DAZ4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DAZ4-2542HF | Recombinant Full Length Human DAZ4 Protein, GST-tagged | +Inquiry |
DAZ4-2356H | Recombinant Human DAZ4 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DAZ4-7070HCL | Recombinant Human DAZ4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DAZ4 Products
Required fields are marked with *
My Review for All DAZ4 Products
Required fields are marked with *