Recombinant Human DAZ4 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | DAZ4-4134H |
Product Overview : | DAZ4 MS Standard C13 and N15-labeled recombinant protein (NP_065153) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). Its expression is restricted to premeiotic germ cells, particularly in spermatogonia. It encodes an RNA-binding protein that is important for spermatogenesis. Four copies of this gene are found on chromosome Y within palindromic duplications; one pair of genes is part of the P2 palindrome and the second pair is part of the P1 palindrome. Each gene contains a 2.4 kb repeat including a 72-bp exon, called the DAZ repeat; the number of DAZ repeats is variable and there are several variations in the sequence of the DAZ repeat. Each copy of the gene also contains a 10.8 kb region that may be amplified; this region includes five exons that encode an RNA recognition motif (RRM) domain. This gene contains two copies of the 10.8 kb repeat. Alternatively spliced transcript variants encoding different isoforms have been described. |
Molecular Mass : | 44.1 kDa |
AA Sequence : | MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLCARHVQPRPLVVNPPPPPQFQNVWRNPNTETYLQPQITPNPVTQHVQAYSAYPHSPGQVITGCQLLVYNYQEYPTYPDSAFQVTTGYQLPVYNYQPFPAYPRSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQPFPAYPSSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQAFPAYPNSPVQVTTGYQLPVYNYQAFPAYPNSAVQVTTGYQFHVYNYQMPPQCPVGEQRRNLWTEAYKWWYLVCLIQRRDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | DAZ4 deleted in azoospermia 4 [ Homo sapiens (human) ] |
Official Symbol | DAZ4 |
Synonyms | DAZ4; deleted in azoospermia 4; deleted in azoospermia protein 4; pDP1680; pDP1681; |
Gene ID | 57135 |
mRNA Refseq | NM_020420 |
Protein Refseq | NP_065153 |
MIM | 400048 |
UniProt ID | Q86SG3 |
◆ Recombinant Proteins | ||
DAZ4-2542HF | Recombinant Full Length Human DAZ4 Protein, GST-tagged | +Inquiry |
DAZ4-2356H | Recombinant Human DAZ4 Protein, GST-tagged | +Inquiry |
DAZ4-11835H | Recombinant Human DAZ4, GST-tagged | +Inquiry |
DAZ4-4134H | Recombinant Human DAZ4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
DAZ4-7070HCL | Recombinant Human DAZ4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DAZ4 Products
Required fields are marked with *
My Review for All DAZ4 Products
Required fields are marked with *
0
Inquiry Basket