Recombinant Human DAZAP1 Protein, GST-tagged
| Cat.No. : | DAZAP1-2357H |
| Product Overview : | Human DAZAP1 full-length ORF ( NP_061832.2, 1 a.a. - 407 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | In mammals, the Y chromosome directs the development of the testes and plays an important role in spermatogenesis. A high percentage of infertile men have deletions that map to regions of the Y chromosome. The DAZ (deleted in azoospermia) gene cluster maps to the AZFc region of the Y chromosome and is deleted in many azoospermic and severely oligospermic men. It is thought that the DAZ gene cluster arose from the transposition, amplification, and pruning of the ancestral autosomal gene DAZL also involved in germ cell development and gametogenesis. This gene encodes a RNA-binding protein with two RNP motifs that was originally identified by its interaction with the infertility factors DAZ and DAZL. Two isoforms are encoded by transcript variants of this gene. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 69.8 kDa |
| AA Sequence : | MNNSGADEIGKLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLASRPHTLDGRNIDPKPCTPRGMQPERTRPKEGWQKGPRSDNSKSNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPRDSKSQAPGQPGASQWGSRVVPNAANGWAGQPPPTWQQGYGPQGMWVPAGQAIGGYGPPPAGRGAPPPPPPFTSYIVSTPPGGFPPPQGFPQGYGAPPQFSFGYGPPPPPPDQFAPPGVPPPPATPGAAPLAFPPPPSQAAPDMSKPPTAQPDFPYGQYAGYGQDLSGFGQGFSDPSQQPPSYGGPSVPGSGGPPAGGSGFGRGQNHNVQGFHPYRR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DAZAP1 DAZ associated protein 1 [ Homo sapiens ] |
| Official Symbol | DAZAP1 |
| Synonyms | DAZAP1; DAZ associated protein 1; DAZ-associated protein 1; deleted in azoospermia associated protein 1; MGC19907; deleted in azoospermia-associated protein 1; |
| Gene ID | 26528 |
| mRNA Refseq | NM_018959 |
| Protein Refseq | NP_061832 |
| MIM | 607430 |
| UniProt ID | Q96EP5 |
| ◆ Recombinant Proteins | ||
| DAZAP1-1698HFL | Recombinant Full Length Human DAZAP1 Protein, C-Flag-tagged | +Inquiry |
| Dazap1-2459M | Recombinant Mouse Dazap1 Protein, Myc/DDK-tagged | +Inquiry |
| DAZAP1-7709Z | Recombinant Zebrafish DAZAP1 | +Inquiry |
| DAZAP1-3077C | Recombinant Chicken DAZAP1 | +Inquiry |
| DAZAP1-2357H | Recombinant Human DAZAP1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DAZAP1-7069HCL | Recombinant Human DAZAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DAZAP1 Products
Required fields are marked with *
My Review for All DAZAP1 Products
Required fields are marked with *



