Recombinant Human DBF4 protein, His-tagged
Cat.No. : | DBF4-6842H |
Product Overview : | Recombinant Human DBF4 protein(253-410 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 253-410 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | FDVDKPSSMQKQTQVKLRIQTDGDKYGGTSIQLQLKEKKKKGYCECCLQKYEDLETHLLSEQHRNFAQSNQYQVVDDIVSKLVFDFVEYEKDTPKKKRIKYSVGSLSPVSASVLKKTEQKEKVELQHISQKDCQEDDTTVKEQNFLYKETQETEKKLL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | DBF4 DBF4 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | DBF4 |
Synonyms | DBF4; DBF4 homolog (S. cerevisiae); protein DBF4 homolog A; activator of S phase kinase; ASK; chif; chiffon homolog (Drosophila); DBF4A; ZDBF1; zinc finger; DBF type containing 1; chiffon homolog A; zinc finger, DBF-type containing 1; DBF4-type zinc finger-containing protein 1; CHIF; |
Gene ID | 10926 |
mRNA Refseq | NM_006716 |
Protein Refseq | NP_006707 |
MIM | 604281 |
UniProt ID | Q9UBU7 |
◆ Recombinant Proteins | ||
ASK-908H | Recombinant Human ASK protein, GST-tagged | +Inquiry |
DBF4-7188Z | Recombinant Zebrafish DBF4 | +Inquiry |
DBF4-689H | Recombinant Human DBF4 | +Inquiry |
DBF4-6842H | Recombinant Human DBF4 protein, His-tagged | +Inquiry |
DBF4-2777H | Recombinant Human DBF4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DBF4-7067HCL | Recombinant Human DBF4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DBF4 Products
Required fields are marked with *
My Review for All DBF4 Products
Required fields are marked with *