Recombinant Human DCBLD2 Protein, His-tagged
Cat.No. : | DCBLD2-1780H |
Product Overview : | Recombinant Human DCBLD2 protein(Gln67-Ala528), fused with C-terminal His tag, was expressed in HEK293. |
Availability | August 11, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | Gln67-Ala528 |
Tag : | C-His |
Form : | Liquid in sterile PBS, pH7.4. |
Molecular Mass : | The protein has a calculated MW of 52 kDa. |
Endotoxin : | <1.0EU per 1μg (determined by the LAL method). |
Purity : | > 90 % as determined by SDS-PAGE. |
Storage : | Store it under sterile conditions at -20 to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.73 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | QQGDGCGHTVLGPESGTLTSINYPQTYPNSTVCEWEIRVKMGERVRIKFGDFDIEDSDSCHFNYLRIYNGIGVSRTEIGKYCGLGLQMNHSIESKGNEITLLFMSGIHVSGRGFLASYSVIDKQDLITCLDTASNFLEPEFSKYCPAGCLLPFAEISGTIPHGYRDSSPLCMAGVHAGVVSNTLGGQISVVISKGIPYYESSLANNVTSVVGHLSTSLFTFKTSGCYGTLGMESGVIADPQITASSVLEWTDHTGQENSWKPKKARLKKPGPPWAAFATDEYQWLQIDLNKEKKITGIITTGSTMVEHNYYVSAYRILYSDDGQKWTVYREPGVEQDKIFQGNKDYHQDVRNNFLPPIIARFIRVNPTQWQQKIAMKMELLGCQFIPKGRPPKLTQPPPPRNSNDLKNTTAPPKIAKGRAPKFTQPLQPRSSNEFPAQTEQTTASPDIRNTTVTPNVTKDVAHHHHHHHHHH |
Gene Name | DCBLD2 discoidin, CUB and LCCL domain containing 2 [ Homo sapiens ] |
Official Symbol | DCBLD2 |
Synonyms | DCBLD2; discoidin, CUB and LCCL domain containing 2; discoidin, CUB and LCCL domain-containing protein 2; CLCP1; ESDN; 1700055P21Rik; coagulation factor V/VIII-homology domains protein 1; CUB, LCCL and coagulation factor V/VIII-homology domains protein 1; endothelial and smooth muscle cell-derived neuropilin-like protein; |
Gene ID | 131566 |
mRNA Refseq | NM_080927 |
Protein Refseq | NP_563615 |
MIM | 608698 |
UniProt ID | Q96PD2 |
◆ Recombinant Proteins | ||
DCBLD2-2188H | Recombinant Human DCBLD2 protein, His-tagged | +Inquiry |
DCBLD2-4343M | Recombinant Mouse DCBLD2 Protein | +Inquiry |
DCBLD2-2796HF | Recombinant Full Length Human DCBLD2 Protein, GST-tagged | +Inquiry |
DCBLD2-209H | Recombinant Human DCBLD2, His tagged | +Inquiry |
DCBLD2-5030Z | Recombinant Zebrafish DCBLD2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCBLD2-868HCL | Recombinant Human DCBLD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DCBLD2 Products
Required fields are marked with *
My Review for All DCBLD2 Products
Required fields are marked with *