Recombinant Human DCHS1 protein, GST-tagged
Cat.No. : | DCHS1-301448H |
Product Overview : | Recombinant Human DCHS1 (1517-1718 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1517-Asn1718 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MPANASRRRAARVSARVFVTDENDNAPVFASPSRVRLPEDQPPGPAALHVVARDPDLGEAARVSYRLASGGDGHFRLHSSTGALSVVRPLDREQRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANGQVTYGGVSSESFSLDPDTGVLTTLRALDREEQEEIN |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | DCHS1 dachsous 1 (Drosophila) [ Homo sapiens ] |
Official Symbol | DCHS1 |
Synonyms | FIB1; CDH25; CDHR6; PCDH16 |
Gene ID | 8642 |
mRNA Refseq | NM_003737.2 |
Protein Refseq | NP_003728.1 |
MIM | 603057 |
UniProt ID | Q96JQ0 |
◆ Recombinant Proteins | ||
DCHS1-2230M | Recombinant Mouse DCHS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DCHS1-4348M | Recombinant Mouse DCHS1 Protein | +Inquiry |
DCHS1-301448H | Recombinant Human DCHS1 protein, GST-tagged | +Inquiry |
DCHS1-3041H | Recombinant Human DCHS1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DCHS1 Products
Required fields are marked with *
My Review for All DCHS1 Products
Required fields are marked with *