Recombinant Human DCHS1 protein, His-tagged

Cat.No. : DCHS1-3041H
Product Overview : Recombinant Human DCHS1 protein(1517 - 1718 aa), fused to His tag, was expressed in E. coli.
Availability October 03, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1517 - 1718 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MPANASRRRAARVSARVFVTDENDNAPVFASPSRVRLPEDQPPGPAALHVVARDPDLGEAARVSYRLASGGDGHFRLHSSTGALSVVRPLDREQRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANGQVTYGGVSSESFSLDPDTGVLTTLRALDREEQEEIN
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name DCHS1 dachsous 1 (Drosophila) [ Homo sapiens ]
Official Symbol DCHS1
Synonyms FIB1; CDH25; CDHR6; PCDH16
Gene ID 8642
mRNA Refseq NM_003737.2
Protein Refseq NP_003728.1
MIM 603057
UniProt ID Q96JQ0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DCHS1 Products

Required fields are marked with *

My Review for All DCHS1 Products

Required fields are marked with *

0
cart-icon
0
compare icon