Recombinant Human DCN protein, GST-tagged
| Cat.No. : | DCN-6844H |
| Product Overview : | Recombinant Human DCN protein(31-172 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 31-172 aa |
| Tag : | N-GST |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | DEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNG |
| Gene Name | DCN decorin [ Homo sapiens ] |
| Official Symbol | DCN |
| Synonyms | DCN; decorin; decorin proteoglycan; DSPG2; SLRR1B; PG-S2; bone proteoglycan II; proteoglycan core protein; small leucine-rich protein 1B; dermatan sulphate proteoglycans II; CSCD; PG40; PGII; PGS2; |
| Gene ID | 1634 |
| mRNA Refseq | NM_001920 |
| Protein Refseq | NP_001911 |
| MIM | 125255 |
| UniProt ID | P07585 |
| ◆ Recombinant Proteins | ||
| Dcn-1887M | Active Recombinant Mouse Dcn protein, His-tagged | +Inquiry |
| DCN-2398H | Recombinant Human DCN Protein, GST-tagged | +Inquiry |
| DCN-356H | Recombinant Human DCN Protein (Met1-Lys359) | +Inquiry |
| DCN-5776B | Recombinant Bovine DCN protein, His-tagged | +Inquiry |
| DCN-371S | Recombinant Sheep DCN protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DCN-2274HCL | Recombinant Human DCN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DCN Products
Required fields are marked with *
My Review for All DCN Products
Required fields are marked with *



