Recombinant Human DCP2 Protein (1-385 aa), His-tagged
Cat.No. : | DCP2-1690H |
Product Overview : | Recombinant Human DCP2 Protein (1-385 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Transcription. Protein Description: Full Length of isoform 2. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-385 aa |
Description : | Decapping metalloenzyme that catalyzes the cleavage of the cap structure on mRNAs. Roves the 7-methyl guanine cap structure from mRNA molecules, yielding a 5'-phosphorylated mRNA fragment and 7m-GDP. Necessary for the degradation of mRNAs, both in normal mRNA turnover and in nonsense-mediated mRNA decay. Plays a role in replication-dependent histone mRNA degradation. Has higher activity towards mRNAs that lack a poly(A) tail. Has no activity towards a cap structure lacking an RNA moiety |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 46.4 kDa |
AA Sequence : | METKRVEIPGSVLDDLCSRFILHIPSEERDNAIRVCFQIELAHWFYLDFYMQNTPGLPQCGIRDFAKAVFSHCPFLLPQGEDVEKVLDEWKEYKMGVPTYGAIILDETLENVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGIPKDTKFNPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWLSRRFGDSSDSDNGFSSTGSTPAKPTVEKLSRTKFRHSQQLFPDGSPGDQWVKHRQPLQQKPYNNHSEMSDLLKGKKCEKKLHPRKLQDNFETDAVYDLPSSSEDQLLEHAEGQPVACNGHCKFPFSSRAFLSFKFDHNAIMKILDL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | DCP2 |
Synonyms | DCP2; NUDT20; hDpc; FLJ33245; |
Gene ID | 167227 |
mRNA Refseq | NM_001242377 |
Protein Refseq | NP_001229306 |
MIM | 609844 |
UniProt ID | Q8IU60 |
◆ Recombinant Proteins | ||
DCP2-1193R | Recombinant Rhesus monkey DCP2 Protein, His-tagged | +Inquiry |
DCP2-11861H | Recombinant Human DCP2 protein, His-tagged | +Inquiry |
DCP2-1570H | Recombinant Human DCP2 protein | +Inquiry |
DCP2-2893HF | Recombinant Full Length Human DCP2 Protein, GST-tagged | +Inquiry |
DCP2-1018R | Recombinant Rhesus Macaque DCP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCP2-446HCL | Recombinant Human DCP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DCP2 Products
Required fields are marked with *
My Review for All DCP2 Products
Required fields are marked with *
0
Inquiry Basket