Recombinant Human DCTD Protein, GST-tagged
Cat.No. : | DCTD-2408H |
Product Overview : | Human DCTD full-length ORF ( NP_001012750.1, 1 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene catalyzes the deamination of dCMP to dUMP, the nucleotide substrate for thymidylate synthase. The encoded protein is allosterically activated by dCTP and inhibited by dTTP, and is found as a homohexamer. This protein uses zinc as a cofactor for its activity. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 47.4 kDa |
AA Sequence : | MVGGGQPCGPNMSEVSCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNGCSDDVLPWRRTAENKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKLQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DCTD dCMP deaminase [ Homo sapiens ] |
Official Symbol | DCTD |
Synonyms | DCTD; dCMP deaminase; deoxycytidylate deaminase; MGC111062; |
Gene ID | 1635 |
mRNA Refseq | NM_001012732 |
Protein Refseq | NP_001012750 |
MIM | 607638 |
UniProt ID | P32321 |
◆ Recombinant Proteins | ||
DCTD-732H | Recombinant Human dCMP Deaminase, His-tagged | +Inquiry |
DCTD-4638H | Recombinant Human DCTD Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DCTD-1457R | Recombinant Rat DCTD Protein, His (Fc)-Avi-tagged | +Inquiry |
DCTD-2937HF | Recombinant Full Length Human DCTD Protein, GST-tagged | +Inquiry |
DCTD-1799R | Recombinant Rat DCTD Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCTD-7044HCL | Recombinant Human DCTD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DCTD Products
Required fields are marked with *
My Review for All DCTD Products
Required fields are marked with *