Recombinant Human DCTD Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : DCTD-3317H
Product Overview : DCTD MS Standard C13 and N15-labeled recombinant protein (NP_001012750) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene catalyzes the deamination of dCMP to dUMP, the nucleotide substrate for thymidylate synthase. The encoded protein is allosterically activated by dCTP and inhibited by dTTP, and is found as a homohexamer. This protein uses zinc as a cofactor for its activity. Two transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 20.8 kDa
AA Sequence : MVGGGQPCGPNMSEVSCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNGCSDDVLPWRRTAENKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKLQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name DCTD dCMP deaminase [ Homo sapiens (human) ]
Official Symbol DCTD
Synonyms DCTD; dCMP deaminase; deoxycytidylate deaminase; MGC111062;
Gene ID 1635
mRNA Refseq NM_001012732
Protein Refseq NP_001012750
MIM 607638
UniProt ID P32321

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DCTD Products

Required fields are marked with *

My Review for All DCTD Products

Required fields are marked with *

0
cart-icon
0
compare icon