Recombinant Human DCUN1D1, His-tagged

Cat.No. : DCUN1D1-26174TH
Product Overview : Recombinant full length Human DCUN1D1 with an N terminal His tag; 279 amino acids with a predicted MWt 32.2 kDa including tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 259 amino acids
Description : DCUN1D1, also known as DCN1-like protein 1, is involved in the malignant transformation of squamous cell lineage.
Conjugation : HIS
Molecular Weight : 32.200kDa inclusive of tags
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTTV
Gene Name DCUN1D1 DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae) [ Homo sapiens ]
Official Symbol DCUN1D1
Synonyms DCUN1D1; DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae); DCN1-like protein 1; DCUN1L1; RP42; SCCRO; SCRO; Tes3;
Gene ID 54165
mRNA Refseq NM_020640
Protein Refseq NP_065691
MIM 605905
Uniprot ID Q96GG9
Chromosome Location 3q26.3
Function protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DCUN1D1 Products

Required fields are marked with *

My Review for All DCUN1D1 Products

Required fields are marked with *

0
cart-icon
0
compare icon