Recombinant Human DCUN1D1, His-tagged
Cat.No. : | DCUN1D1-26174TH |
Product Overview : | Recombinant full length Human DCUN1D1 with an N terminal His tag; 279 amino acids with a predicted MWt 32.2 kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 259 amino acids |
Description : | DCUN1D1, also known as DCN1-like protein 1, is involved in the malignant transformation of squamous cell lineage. |
Conjugation : | HIS |
Molecular Weight : | 32.200kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, pH 8.0 |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTTV |
Gene Name | DCUN1D1 DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | DCUN1D1 |
Synonyms | DCUN1D1; DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae); DCN1-like protein 1; DCUN1L1; RP42; SCCRO; SCRO; Tes3; |
Gene ID | 54165 |
mRNA Refseq | NM_020640 |
Protein Refseq | NP_065691 |
MIM | 605905 |
Uniprot ID | Q96GG9 |
Chromosome Location | 3q26.3 |
Function | protein binding; |
◆ Recombinant Proteins | ||
DCUN1D1-10161Z | Recombinant Zebrafish DCUN1D1 | +Inquiry |
Dcun1d1-537M | Recombinant Mouse Dcun1d1 Protein, MYC/DDK-tagged | +Inquiry |
DCUN1D1-2972C | Recombinant Chicken DCUN1D1 | +Inquiry |
DCUN1D1-2418H | Recombinant Human DCUN1D1 Protein, GST-tagged | +Inquiry |
DCUN1D1-4659H | Recombinant Human DCUN1D1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCUN1D1-7035HCL | Recombinant Human DCUN1D1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DCUN1D1 Products
Required fields are marked with *
My Review for All DCUN1D1 Products
Required fields are marked with *