Species : |
Human |
Source : |
E.coli |
Tag : |
His |
Protein Length : |
1-365 a.a. |
Description : |
This gene encodes a member of the doublecortin family. The protein encoded by this gene is a cytoplasmic protein and contains two doublecortin domains, which bind microtubules. In the developing cortex, cortical neurons must migrate over long distances to reach the site of their final differentiation. The encoded protein appears to direct neuronal migration by regulating the organization and stability of microtubules. In addition, the encoded protein interacts with LIS1, the regulatory gamma subunit of platelet activating factor acetylhydrolase, and this interaction is important to proper microtubule function in the developing cortex. Mutations in this gene cause abnormal migration of neurons during development and disrupt the layering of the cortex, leading to epilepsy, mental retardation, subcortical band heterotopia ("double cortex" syndrome) in females and lissencephaly ("smooth brain" syndrome) in males. Multiple transcript variants encoding different isoforms have been found for this gene. |
Conjugation : |
HIS |
Tissue specificity : |
Highly expressed in neuronal cells of fetal brain (in the majority of cells of the cortical plate, intermediate zone and ventricular zone), but not expressed in other fetal tissues. In the adult, highly expressed in the brain frontal lobe, but very low ex |
Form : |
Lyophilised:Reconstitute with 83 μl distilled water. |
Storage buffer : |
Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : |
Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : |
MELDFGHFDERDKTSRNMRGSRMNGLPSPTHSAHCSFYRT RTLQALSNEKKAKKVRFYRNGDRYFKGIVYAVSSDRFR SFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSM DELEEGESYVCSSDNFFKKVEYTKNVNPNWSVNVKTSANM KAPQSLASSNSAQARENKDFVRPKLVTIIRSGVKPRKA VRVLLNKKTAHSFEQVLTDITEAIKLETGVVKKLYTLD GKQVTCLHDFFGDDDVFIACGPEKFRYAQDDFSLDENECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRRSKSPADS GNDQDANGTSSSQLSTPKSKQSPISTPTSPGSLRKHKD LYLPLSLDDSDSLGDSM |
Sequence Similarities : |
Contains 2 doublecortin domains. |
Full Length : |
Full L. |