Recombinant Human DDR1 protein, His-tagged

• Cat.No.: DDR1-2853H
• Product Overview: Recombinant Human DDR1 protein(439-530 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 439-530 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: WRLHWRRLLSKAERRVLEEELTVHLSVPGDTILINNRPGPREPPPYQEPRPRGNPPHSAPCVPNGSAYSGDYMEPEKPGAPLLPPPPQNSVP
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: DDR1 discoidin domain receptor tyrosine kinase 1 [ Homo sapiens ]
• Official Symbol: DDR1
• Synonyms: DDR1; discoidin domain receptor tyrosine kinase 1; CAK, discoidin domain receptor family, member 1 , EDDR1, NEP, NTRK4, PTK3A; epithelial discoidin domain-containing receptor 1; CD167; RTK6; tyrosine kinase DDR; cell adhesion kinase; mammary carcinoma kinase 10; tyrosine-protein kinase CAK; protein-tyrosine kinase RTK-6; neuroepithelial tyrosine kinase; PTK3A protein tyrosine kinase 3A; CD167 antigen-like family member A; neurotrophic tyrosine kinase, receptor, type 4; CAK; DDR; NEP; HGK2; PTK3; TRKE; EDDR1; MCK10; NTRK4; PTK3A
• Gene ID: 780
• mRNA Refseq: NM_001202521
• Protein Refseq: NP_001189450
• MIM: 600408
• UniProt ID: Q08345