Recombinant Human DDR1 protein, His-tagged
Cat.No. : | DDR1-2853H |
Product Overview : | Recombinant Human DDR1 protein(439-530 aa), fused to His tag, was expressed in E. coli. |
Availability | August 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 439-530 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | WRLHWRRLLSKAERRVLEEELTVHLSVPGDTILINNRPGPREPPPYQEPRPRGNPPHSAPCVPNGSAYSGDYMEPEKPGAPLLPPPPQNSVP |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | DDR1 discoidin domain receptor tyrosine kinase 1 [ Homo sapiens ] |
Official Symbol | DDR1 |
Synonyms | DDR1; discoidin domain receptor tyrosine kinase 1; CAK, discoidin domain receptor family, member 1 , EDDR1, NEP, NTRK4, PTK3A; epithelial discoidin domain-containing receptor 1; CD167; RTK6; tyrosine kinase DDR; cell adhesion kinase; mammary carcinoma kinase 10; tyrosine-protein kinase CAK; protein-tyrosine kinase RTK-6; neuroepithelial tyrosine kinase; PTK3A protein tyrosine kinase 3A; CD167 antigen-like family member A; neurotrophic tyrosine kinase, receptor, type 4; CAK; DDR; NEP; HGK2; PTK3; TRKE; EDDR1; MCK10; NTRK4; PTK3A; |
Gene ID | 780 |
mRNA Refseq | NM_001202521 |
Protein Refseq | NP_001189450 |
MIM | 600408 |
UniProt ID | Q08345 |
◆ Recombinant Proteins | ||
Ddr1-741M | Recombinant Mouse Ddr1 Protein, MYC/DDK-tagged | +Inquiry |
DDR1-2454H | Recombinant Human DDR1 Protein, GST-tagged | +Inquiry |
DDR1-219H | Recombinant Human DDR1 Protein, DDK-tagged | +Inquiry |
DDR1-826HFL | Recombinant Full Length Human DDR1 Protein, C-DDK-tagged | +Inquiry |
DDR1-1593R | Recombinant Rhesus Monkey DDR1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDR1-2534HCL | Recombinant Human DDR1 cell lysate | +Inquiry |
DDR1-401MCL | Recombinant Mouse DDR1 cell lysate | +Inquiry |
DDR1-1081RCL | Recombinant Rat DDR1 cell lysate | +Inquiry |
DDR1-1709MCL | Recombinant Mouse DDR1 cell lysate | +Inquiry |
DDR1-001HCL | Recombinant Human DDR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDR1 Products
Required fields are marked with *
My Review for All DDR1 Products
Required fields are marked with *