Recombinant Human DDX18 protein, His-tagged

Cat.No. : DDX18-2759H
Product Overview : Recombinant Human DDX18 protein(), fused to His tag, was expressed in E. coli.
Availability September 04, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : KLLRKKIEKRNLKLRQRNLKFQGASNLTLSETQNGDVSEETMGSRKVKKSKQKPMNVGLSETQNGGMSQEAVGNIKVTKSPQKSTVLTNGEAAMQSSNSESKKKKKKKRKMVNDAEPDTKKAKTENKGKSEEESAETTKETENNVEKPDNDEDESEVPS
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name DDX18 DEAD (Asp-Glu-Ala-Asp) box polypeptide 18 [ Homo sapiens ]
Official Symbol DDX18
Synonyms DDX18; DEAD (Asp-Glu-Ala-Asp) box polypeptide 18; DEAD/H (Asp Glu Ala Asp/His) box polypeptide 18 (Myc regulated); ATP-dependent RNA helicase DDX18; MrDb; DEAD box protein 18; Myc-regulated DEAD box protein; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 18 (Myc-regulated); FLJ33908;
Gene ID 8886
mRNA Refseq NM_006773
Protein Refseq NP_006764
MIM 606355
UniProt ID Q9NVP1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DDX18 Products

Required fields are marked with *

My Review for All DDX18 Products

Required fields are marked with *

0
cart-icon