Recombinant Human DDX18 protein, His-tagged

• Cat.No.: DDX18-2759H
• Product Overview: Recombinant Human DDX18 protein(), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: KLLRKKIEKRNLKLRQRNLKFQGASNLTLSETQNGDVSEETMGSRKVKKSKQKPMNVGLSETQNGGMSQEAVGNIKVTKSPQKSTVLTNGEAAMQSSNSESKKKKKKKRKMVNDAEPDTKKAKTENKGKSEEESAETTKETENNVEKPDNDEDESEVPS
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: DDX18 DEAD (Asp-Glu-Ala-Asp) box polypeptide 18 [ Homo sapiens ]
• Official Symbol: DDX18
• Synonyms: DDX18; DEAD (Asp-Glu-Ala-Asp) box polypeptide 18; DEAD/H (Asp Glu Ala Asp/His) box polypeptide 18 (Myc regulated); ATP-dependent RNA helicase DDX18; MrDb; DEAD box protein 18; Myc-regulated DEAD box protein; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 18 (Myc-regulated); FLJ33908
• Gene ID: 8886
• mRNA Refseq: NM_006773
• Protein Refseq: NP_006764
• MIM: 606355
• UniProt ID: Q9NVP1