Recombinant Human DDX18 protein, His-tagged
Cat.No. : | DDX18-2759H |
Product Overview : | Recombinant Human DDX18 protein(), fused to His tag, was expressed in E. coli. |
Availability | September 04, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | KLLRKKIEKRNLKLRQRNLKFQGASNLTLSETQNGDVSEETMGSRKVKKSKQKPMNVGLSETQNGGMSQEAVGNIKVTKSPQKSTVLTNGEAAMQSSNSESKKKKKKKRKMVNDAEPDTKKAKTENKGKSEEESAETTKETENNVEKPDNDEDESEVPS |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | DDX18 DEAD (Asp-Glu-Ala-Asp) box polypeptide 18 [ Homo sapiens ] |
Official Symbol | DDX18 |
Synonyms | DDX18; DEAD (Asp-Glu-Ala-Asp) box polypeptide 18; DEAD/H (Asp Glu Ala Asp/His) box polypeptide 18 (Myc regulated); ATP-dependent RNA helicase DDX18; MrDb; DEAD box protein 18; Myc-regulated DEAD box protein; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 18 (Myc-regulated); FLJ33908; |
Gene ID | 8886 |
mRNA Refseq | NM_006773 |
Protein Refseq | NP_006764 |
MIM | 606355 |
UniProt ID | Q9NVP1 |
◆ Recombinant Proteins | ||
DDX18-2466H | Recombinant Human DDX18 Protein, GST-tagged | +Inquiry |
DDX18-2759H | Recombinant Human DDX18 protein, His-tagged | +Inquiry |
DDX18-1395H | Recombinant Human DDX18 Protein, His-tagged | +Inquiry |
DDX18-864Z | Recombinant Zebrafish DDX18 | +Inquiry |
DDX18-2529HF | Recombinant Full Length Human DDX18 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDX18-7019HCL | Recombinant Human DDX18 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDX18 Products
Required fields are marked with *
My Review for All DDX18 Products
Required fields are marked with *