Recombinant Human DDX18 protein, His-tagged
| Cat.No. : | DDX18-2759H |
| Product Overview : | Recombinant Human DDX18 protein(), fused to His tag, was expressed in E. coli. |
| Availability | July 22, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | KLLRKKIEKRNLKLRQRNLKFQGASNLTLSETQNGDVSEETMGSRKVKKSKQKPMNVGLSETQNGGMSQEAVGNIKVTKSPQKSTVLTNGEAAMQSSNSESKKKKKKKRKMVNDAEPDTKKAKTENKGKSEEESAETTKETENNVEKPDNDEDESEVPS |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | DDX18 DEAD (Asp-Glu-Ala-Asp) box polypeptide 18 [ Homo sapiens ] |
| Official Symbol | DDX18 |
| Synonyms | DDX18; DEAD (Asp-Glu-Ala-Asp) box polypeptide 18; DEAD/H (Asp Glu Ala Asp/His) box polypeptide 18 (Myc regulated); ATP-dependent RNA helicase DDX18; MrDb; DEAD box protein 18; Myc-regulated DEAD box protein; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 18 (Myc-regulated); FLJ33908; |
| Gene ID | 8886 |
| mRNA Refseq | NM_006773 |
| Protein Refseq | NP_006764 |
| MIM | 606355 |
| UniProt ID | Q9NVP1 |
| ◆ Recombinant Proteins | ||
| DDX18-2529HF | Recombinant Full Length Human DDX18 Protein, GST-tagged | +Inquiry |
| DDX18-2759H | Recombinant Human DDX18 protein, His-tagged | +Inquiry |
| DDX18-1395H | Recombinant Human DDX18 Protein, His-tagged | +Inquiry |
| DDX18-864Z | Recombinant Zebrafish DDX18 | +Inquiry |
| DDX18-2466H | Recombinant Human DDX18 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DDX18-7019HCL | Recombinant Human DDX18 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDX18 Products
Required fields are marked with *
My Review for All DDX18 Products
Required fields are marked with *




