Recombinant Human DDX21 protein, His-tagged

Cat.No. : DDX21-2902H
Product Overview : Recombinant Human DDX21 protein(620-783 aa), fused to His tag, was expressed in E. coli.
Availability November 29, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 620-783 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : GATSVDQRSLINSNVGFVTMILQCSIEMPNISYAWKELKEQLGEEIDSKVKGMVFLKGKLGVCFDVPTASVTEIQEKWHDSRRWQLSVATEQPELEGPREGYGGFRGQREGSRGFRGQRDGNRRFRGQREGSRGPRGQRSGGGNKSNRSQNKGQKRSFSKAFGQ
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name DDX21 DEAD (Asp-Glu-Ala-Asp) box helicase 21 [ Homo sapiens ]
Official Symbol DDX21
Synonyms DDX21; DEAD (Asp-Glu-Ala-Asp) box helicase 21; DEAD (Asp Glu Ala Asp) box polypeptide 21 , DEAD/H (Asp Glu Ala Asp/His) box polypeptide 21; nucleolar RNA helicase 2; GURDB; RH II/GU; RH II/Gu; gu-alpha; Gu protein; DEAD box protein 21; RNA helicase II/Gu alpha; nucleolar RNA helicase Gu; nucleolar RNA helicase II; DEAD (Asp-Glu-Ala-Asp) box polypeptide 21; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 21; GUA; RH-II/GU; RH-II/GuA; DKFZp686F21172;
Gene ID 9188
mRNA Refseq NM_001256910
Protein Refseq NP_001243839
MIM 606357
UniProt ID Q9NR30

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DDX21 Products

Required fields are marked with *

My Review for All DDX21 Products

Required fields are marked with *

0
cart-icon
0
compare icon