Recombinant Human DDX21 protein, His-tagged
Cat.No. : | DDX21-2902H |
Product Overview : | Recombinant Human DDX21 protein(620-783 aa), fused to His tag, was expressed in E. coli. |
Availability | August 07, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 620-783 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | GATSVDQRSLINSNVGFVTMILQCSIEMPNISYAWKELKEQLGEEIDSKVKGMVFLKGKLGVCFDVPTASVTEIQEKWHDSRRWQLSVATEQPELEGPREGYGGFRGQREGSRGFRGQRDGNRRFRGQREGSRGPRGQRSGGGNKSNRSQNKGQKRSFSKAFGQ |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | DDX21 DEAD (Asp-Glu-Ala-Asp) box helicase 21 [ Homo sapiens ] |
Official Symbol | DDX21 |
Synonyms | DDX21; DEAD (Asp-Glu-Ala-Asp) box helicase 21; DEAD (Asp Glu Ala Asp) box polypeptide 21 , DEAD/H (Asp Glu Ala Asp/His) box polypeptide 21; nucleolar RNA helicase 2; GURDB; RH II/GU; RH II/Gu; gu-alpha; Gu protein; DEAD box protein 21; RNA helicase II/Gu alpha; nucleolar RNA helicase Gu; nucleolar RNA helicase II; DEAD (Asp-Glu-Ala-Asp) box polypeptide 21; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 21; GUA; RH-II/GU; RH-II/GuA; DKFZp686F21172; |
Gene ID | 9188 |
mRNA Refseq | NM_001256910 |
Protein Refseq | NP_001243839 |
MIM | 606357 |
UniProt ID | Q9NR30 |
◆ Recombinant Proteins | ||
DDX21-1475R | Recombinant Rat DDX21 Protein, His (Fc)-Avi-tagged | +Inquiry |
DDX21-2902H | Recombinant Human DDX21 protein, His-tagged | +Inquiry |
DDX21-741H | Recombinant Human DDX21 Protein, His (Fc)-Avi-tagged | +Inquiry |
DDX21-2474H | Recombinant Human DDX21 Protein, GST-tagged | +Inquiry |
DDX21-1817R | Recombinant Rat DDX21 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDX21-7015HCL | Recombinant Human DDX21 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDX21 Products
Required fields are marked with *
My Review for All DDX21 Products
Required fields are marked with *