Recombinant Human DDX21 protein, His-tagged

• Cat.No.: DDX21-2902H
• Product Overview: Recombinant Human DDX21 protein(620-783 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 620-783 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: GATSVDQRSLINSNVGFVTMILQCSIEMPNISYAWKELKEQLGEEIDSKVKGMVFLKGKLGVCFDVPTASVTEIQEKWHDSRRWQLSVATEQPELEGPREGYGGFRGQREGSRGFRGQRDGNRRFRGQREGSRGPRGQRSGGGNKSNRSQNKGQKRSFSKAFGQ
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: DDX21 DEAD (Asp-Glu-Ala-Asp) box helicase 21 [ Homo sapiens ]
• Official Symbol: DDX21
• Synonyms: DDX21; DEAD (Asp-Glu-Ala-Asp) box helicase 21; DEAD (Asp Glu Ala Asp) box polypeptide 21 , DEAD/H (Asp Glu Ala Asp/His) box polypeptide 21; nucleolar RNA helicase 2; GURDB; RH II/GU; RH II/Gu; gu-alpha; Gu protein; DEAD box protein 21; RNA helicase II/Gu alpha; nucleolar RNA helicase Gu; nucleolar RNA helicase II; DEAD (Asp-Glu-Ala-Asp) box polypeptide 21; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 21; GUA; RH-II/GU; RH-II/GuA; DKFZp686F21172
• Gene ID: 9188
• mRNA Refseq: NM_001256910
• Protein Refseq: NP_001243839
• MIM: 606357
• UniProt ID: Q9NR30