Recombinant Human DDX43 protein, His-tagged

Cat.No. : DDX43-645H
Product Overview : Recombinant Human DDX43 protein(NP_061135)(264-648 aa), fused with His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 264-648 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
AA Sequence : KPTPIQSQAWPIVLQGIDLIGVAQTGTGKTLCYLMPGFIHLVLQPSLKGQRNRPGMLVLTPTRELALQVEGECCKYSYKGLRSVCVYGGGNRDEQIEELKKGVDIIIATPGRLNDLQMSNFVNLKNITYLVLDEADKMLDMGFEPQIMKILLDVRPDRQTVMTSATWPHSVHRLAQSYLKEPMIVYVGTLDLVAVSSVKQNIIVTTEEEKWSHMQTFLQSMSSTDKVIVFVSRKAVADHLSSDLILGNISVESLHGDREQRDREKALENFKTGKVRILIATDLASRGLDVHDVTHVYNFDFPRNIEEYVHRIGRTGRAGRTGVSITTLTRNDWRVASELINILERANQSIPEELVSMAERFKAHQQKREMERKMERPQGRPKKFH
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name DDX43 DEAD (Asp-Glu-Ala-Asp) box polypeptide 43 [ Homo sapiens ]
Official Symbol DDX43
Synonyms DDX43; DEAD (Asp-Glu-Ala-Asp) box polypeptide 43; probable ATP-dependent RNA helicase DDX43; cancer/testis antigen 13; CT13; DKFZp434H2114; HAGE; helical antigen; DEAD box protein 43; DEAD-box protein 43; DEAD box protein HAGE;
Gene ID 55510
mRNA Refseq NM_018665
Protein Refseq NP_061135
MIM 606286
UniProt ID Q9NXZ2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DDX43 Products

Required fields are marked with *

My Review for All DDX43 Products

Required fields are marked with *

0
cart-icon
0
compare icon