Recombinant Human DDX43 protein, His-tagged

• Cat.No.: DDX43-645H
• Product Overview: Recombinant Human DDX43 protein(NP_061135)(264-648 aa), fused with His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 264-648 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• AA Sequence: KPTPIQSQAWPIVLQGIDLIGVAQTGTGKTLCYLMPGFIHLVLQPSLKGQRNRPGMLVLTPTRELALQVEGECCKYSYKGLRSVCVYGGGNRDEQIEELKKGVDIIIATPGRLNDLQMSNFVNLKNITYLVLDEADKMLDMGFEPQIMKILLDVRPDRQTVMTSATWPHSVHRLAQSYLKEPMIVYVGTLDLVAVSSVKQNIIVTTEEEKWSHMQTFLQSMSSTDKVIVFVSRKAVADHLSSDLILGNISVESLHGDREQRDREKALENFKTGKVRILIATDLASRGLDVHDVTHVYNFDFPRNIEEYVHRIGRTGRAGRTGVSITTLTRNDWRVASELINILERANQSIPEELVSMAERFKAHQQKREMERKMERPQGRPKKFH
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: DDX43 DEAD (Asp-Glu-Ala-Asp) box polypeptide 43 [ Homo sapiens ]
• Official Symbol: DDX43
• Synonyms: DDX43; DEAD (Asp-Glu-Ala-Asp) box polypeptide 43; probable ATP-dependent RNA helicase DDX43; cancer/testis antigen 13; CT13; DKFZp434H2114; HAGE; helical antigen; DEAD box protein 43; DEAD-box protein 43; DEAD box protein HAGE
• Gene ID: 55510
• mRNA Refseq: NM_018665
• Protein Refseq: NP_061135
• MIM: 606286
• UniProt ID: Q9NXZ2