Recombinant Human DDX49 Protein, GST-tagged

• Cat.No.: DDX49-2496H
• Product Overview: Human DDX49 full-length ORF ( NP_061943.2, 1 a.a. - 483 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: DDX49 (DEAD-Box Helicase 49) is a Protein Coding gene. Among its related pathways are rRNA processing in the nucleus and cytosol and Gene Expression. GO annotations related to this gene include nucleic acid binding and ATP-dependent RNA helicase activity.
• Molecular Mass: 80.6 kDa
• AA Sequence: MAGFAELGLSSWLVEQCRQLGLKQPTPVQLGCIPAILEGRDCLGCAKTGSGKTAAFVLPILQKLSEDPYGIFCLVLTPTRELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVAQALELSRKPHVVIATPGRLADHLRSSNTFSIKKIRFLVMDEADRLLEQGCTDFTVDLEAILAAVPARRQTLLFSATLTDTLRELQGLATNQPFFWEAQAPVSTVEQLDQRYLLVPEKVKDAYLVHLIQRFQDEHEDWSIIIFTNTCKTCQILCMMLRKFSFPTVALHSMMKQKERFAALAKFKSSIYRILIATDVASRGLDIPTVQVVINHNTPGLPKIYIHRVGRTARAGRQGQAITLVTQYDIHLVHAIEEQIKKKLEEFSVEEAEVLQILTQVNVVRRECEIKLEAAHFDEKKEINKRKQLILEGKDPDLEAKRKAELAKIKQKNRRFKEKVEETLKRQKAGRAGHKGRPPRTPSGSHSGPVPSQGLV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DDX49 DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 [ Homo sapiens ]
• Official Symbol: DDX49
• Synonyms: DDX49; DEAD (Asp-Glu-Ala-Asp) box polypeptide 49; probable ATP-dependent RNA helicase DDX49; FLJ10432; DEAD box protein 49; R27090_2
• Gene ID: 54555
• mRNA Refseq: NM_019070
• Protein Refseq: NP_061943
• UniProt ID: Q9Y6V7