Recombinant Human DDX58 protein, His-tagged

Cat.No. : DDX58-2068H
Product Overview : Recombinant Human DDX58 protein(575-925 aa), fused with N-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 575-925 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AASequence : RAAGFDEIEQDLTQRFEEKLQELESVSRDPSNENPKLEDLCFILQEEYHLNPETITILFVKTRALVDALKNWIEGNPKLSFLKPGILTGRGKTNQNTGMTLPAQKCILDAFKASGDHNILIATSVADEGIDIAQCNLVILYEYVGNVIKMIQTRGRGRARGSKCFLLTSNAGVIEKEQINMYKEKMMNDSILRLQTWDEAVFREKILHIQTHEKFIRDSQEKPKPVPDKENKKLLCRKCKALACYTADVRVIEECHYTVLGDAFKECFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATGVQTLYSKWKDFHFEKIPFDPAEMSK
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Samples are stable for up to twelve months from date of receipt at -20°C to -80°C. Store it under sterile conditions at -20°C to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
Gene Name DDX58 DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 [ Homo sapiens ]
Official Symbol DDX58
Synonyms DDX58; DEAD (Asp-Glu-Ala-Asp) box polypeptide 58; probable ATP-dependent RNA helicase DDX58; DKFZp434J1111; FLJ13599; retinoic acid inducible gene I; RIG I; RNA helicase RIG I; RIG-1; RNA helicase RIG-I; DEAD box protein 58; retinoic acid-inducible gene 1 protein; retinoic acid-inducible gene I protein; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide; RIG-I; DKFZp686N19181;
Gene ID 23586
mRNA Refseq NM_014314
Protein Refseq NP_055129
MIM 609631
UniProt ID O95786

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DDX58 Products

Required fields are marked with *

My Review for All DDX58 Products

Required fields are marked with *

0
cart-icon
0
compare icon