Recombinant Human RNA sensor RIG-I Protein, His tagged
| Cat.No. : | DDX58-001H |
| Product Overview : | Recombinant Human DDX58 Protein (724-925aa) with C-His tag was expressed in E. coli. |
| Availability | June 03, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 724-925aa |
| Description : | DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases which are implicated in a number of cellular processes involving RNA binding and alteration of RNA secondary structure. This gene encodes a protein containing RNA helicase-DEAD box protein motifs and a caspase recruitment domain (CARD). It is involved in viral double-stranded (ds) RNA recognition and the regulation of the antiviral innate immune response. Mutations in this gene are associated with Singleton-Merten syndrome 2. |
| Tag : | C-His |
| Molecular Mass : | 25 kDa |
| AA Sequence : | MIQTRGRGRARGSKCFLLTSNAGVIEKEQINMYKEKMMNDSILRLQTWDEAVFREKILHIQTHEKFIRDSQEKPKPVPDKENKKLLCRKCKALACYTADVRVIEECHYTVLGDAFKECFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATGVQTLYSKWKDFHFEKIPFDPAEMSKHHHHHHHH |
| Endotoxin : | < 1 EU/μg by LAL |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile PBS, pH7.4, 200mM Arginine |
| Concentration : | 1 mg/mL by BCA |
| Gene Name | RIGI RNA sensor RIG-I [ Homo sapiens (human) ] |
| Official Symbol | RIGI |
| Synonyms | DDX58; DEAD (Asp-Glu-Ala-Asp) box polypeptide 58; probable ATP-dependent RNA helicase DDX58; DKFZp434J1111; FLJ13599; retinoic acid inducible gene I; RIG I; RNA helicase RIG I; RIG-1; RNA helicase RIG-I; DEAD box protein 58; retinoic acid-inducible gene 1 protein; retinoic acid-inducible gene I protein; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide; RIG-I; DKFZp686N19181 |
| Gene ID | 23586 |
| mRNA Refseq | NM_014314 |
| Protein Refseq | NP_055129 |
| MIM | 609631 |
| UniProt ID | O95786 |
| ◆ Recombinant Proteins | ||
| DDX58-7087H | Recombinant Human DDX58 protein, His-tagged | +Inquiry |
| DDX58-6897HF | Recombinant Full Length Human DDX58 Protein, GST-tagged | +Inquiry |
| DDX58-1048R | Recombinant Rhesus Macaque DDX58 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DDX58-2068H | Recombinant Human DDX58 protein, His-tagged | +Inquiry |
| DDX58-452H | Recombinant Human DDX58 Protein (1-430 aa), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DDX58-7000HCL | Recombinant Human DDX58 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDX58 Products
Required fields are marked with *
My Review for All DDX58 Products
Required fields are marked with *
