Recombinant Human RNA sensor RIG-I Protein, His tagged

• Cat.No.: DDX58-001H
• Product Overview: Recombinant Human DDX58 Protein (724-925aa) with C-His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 724-925aa
• Description: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases which are implicated in a number of cellular processes involving RNA binding and alteration of RNA secondary structure. This gene encodes a protein containing RNA helicase-DEAD box protein motifs and a caspase recruitment domain (CARD). It is involved in viral double-stranded (ds) RNA recognition and the regulation of the antiviral innate immune response. Mutations in this gene are associated with Singleton-Merten syndrome 2.
• Tag: C-His
• Molecular Mass: 25 kDa
• AA Sequence: MIQTRGRGRARGSKCFLLTSNAGVIEKEQINMYKEKMMNDSILRLQTWDEAVFREKILHIQTHEKFIRDSQEKPKPVPDKENKKLLCRKCKALACYTADVRVIEECHYTVLGDAFKECFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATGVQTLYSKWKDFHFEKIPFDPAEMSKHHHHHHHH
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4, 200mM Arginine
• Concentration: 1 mg/mL by BCA

Gene Information

• Gene Name: RIGI RNA sensor RIG-I [ Homo sapiens (human) ]
• Official Symbol: RIGI
• Synonyms: DDX58; DEAD (Asp-Glu-Ala-Asp) box polypeptide 58; probable ATP-dependent RNA helicase DDX58; DKFZp434J1111; FLJ13599; retinoic acid inducible gene I; RIG I; RNA helicase RIG I; RIG-1; RNA helicase RIG-I; DEAD box protein 58; retinoic acid-inducible gene 1 protein; retinoic acid-inducible gene I protein; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide; RIG-I; DKFZp686N19181
• Gene ID: 23586
• mRNA Refseq: NM_014314
• Protein Refseq: NP_055129
• MIM: 609631
• UniProt ID: O95786