Recombinant Human RNA sensor RIG-I Protein, His tagged

Cat.No. : DDX58-001H
Product Overview : Recombinant Human DDX58 Protein (724-925aa) with C-His tag was expressed in E. coli.
Availability April 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 724-925aa
Description : DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases which are implicated in a number of cellular processes involving RNA binding and alteration of RNA secondary structure. This gene encodes a protein containing RNA helicase-DEAD box protein motifs and a caspase recruitment domain (CARD). It is involved in viral double-stranded (ds) RNA recognition and the regulation of the antiviral innate immune response. Mutations in this gene are associated with Singleton-Merten syndrome 2.
Tag : C-His
Molecular Mass : 25 kDa
AA Sequence : MIQTRGRGRARGSKCFLLTSNAGVIEKEQINMYKEKMMNDSILRLQTWDEAVFREKILHIQTHEKFIRDSQEKPKPVPDKENKKLLCRKCKALACYTADVRVIEECHYTVLGDAFKECFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATGVQTLYSKWKDFHFEKIPFDPAEMSKHHHHHHHH
Endotoxin : < 1 EU/μg by LAL
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4, 200mM Arginine
Concentration : 1 mg/mL by BCA
Gene Name RIGI RNA sensor RIG-I [ Homo sapiens (human) ]
Official Symbol RIGI
Synonyms DDX58; DEAD (Asp-Glu-Ala-Asp) box polypeptide 58; probable ATP-dependent RNA helicase DDX58; DKFZp434J1111; FLJ13599; retinoic acid inducible gene I; RIG I; RNA helicase RIG I; RIG-1; RNA helicase RIG-I; DEAD box protein 58; retinoic acid-inducible gene 1 protein; retinoic acid-inducible gene I protein; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide; RIG-I; DKFZp686N19181
Gene ID 23586
mRNA Refseq NM_014314
Protein Refseq NP_055129
MIM 609631
UniProt ID O95786

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DDX58 Products

Required fields are marked with *

My Review for All DDX58 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon