Recombinant Human RNA sensor RIG-I Protein, His tagged
Cat.No. : | DDX58-001H |
Product Overview : | Recombinant Human DDX58 Protein (724-925aa) with C-His tag was expressed in E. coli. |
Availability | August 11, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 724-925aa |
Description : | DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases which are implicated in a number of cellular processes involving RNA binding and alteration of RNA secondary structure. This gene encodes a protein containing RNA helicase-DEAD box protein motifs and a caspase recruitment domain (CARD). It is involved in viral double-stranded (ds) RNA recognition and the regulation of the antiviral innate immune response. Mutations in this gene are associated with Singleton-Merten syndrome 2. |
Tag : | C-His |
Molecular Mass : | 25 kDa |
AA Sequence : | MIQTRGRGRARGSKCFLLTSNAGVIEKEQINMYKEKMMNDSILRLQTWDEAVFREKILHIQTHEKFIRDSQEKPKPVPDKENKKLLCRKCKALACYTADVRVIEECHYTVLGDAFKECFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATGVQTLYSKWKDFHFEKIPFDPAEMSKHHHHHHHH |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4, 200mM Arginine |
Concentration : | 1 mg/mL by BCA |
Gene Name | RIGI RNA sensor RIG-I [ Homo sapiens (human) ] |
Official Symbol | RIGI |
Synonyms | DDX58; DEAD (Asp-Glu-Ala-Asp) box polypeptide 58; probable ATP-dependent RNA helicase DDX58; DKFZp434J1111; FLJ13599; retinoic acid inducible gene I; RIG I; RNA helicase RIG I; RIG-1; RNA helicase RIG-I; DEAD box protein 58; retinoic acid-inducible gene 1 protein; retinoic acid-inducible gene I protein; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide; RIG-I; DKFZp686N19181 |
Gene ID | 23586 |
mRNA Refseq | NM_014314 |
Protein Refseq | NP_055129 |
MIM | 609631 |
UniProt ID | O95786 |
◆ Recombinant Proteins | ||
DDX58-001H | Recombinant Human RNA sensor RIG-I Protein, His tagged | +Inquiry |
Ddx58-2513M | Recombinant Mouse Ddx58 Protein, Myc/DDK-tagged | +Inquiry |
DDX58-2069H | Recombinant Human DDX58 Protein (Ile725-Lys925), N-His tagged | +Inquiry |
DDX58-2070H | Recombinant Human DDX58 Protein () | +Inquiry |
DDX58-6897HF | Recombinant Full Length Human DDX58 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDX58-7000HCL | Recombinant Human DDX58 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDX58 Products
Required fields are marked with *
My Review for All DDX58 Products
Required fields are marked with *